Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 2703235..2703858 | Replicon | chromosome |
Accession | NZ_CP104973 | ||
Organism | Phyllobacterium zundukense strain A18/3m |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | N8E88_RS25645 | Protein ID | WP_262293050.1 |
Coordinates | 2703235..2703414 (+) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | N8E88_RS25650 | Protein ID | WP_262293051.1 |
Coordinates | 2703463..2703858 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8E88_RS25620 (N8E88_25625) | 2698920..2699579 | + | 660 | WP_262293046.1 | dihydrofolate reductase family protein | - |
N8E88_RS25625 (N8E88_25630) | 2699620..2699973 | - | 354 | WP_262295625.1 | CAP-Gly domain protein | - |
N8E88_RS25630 (N8E88_25635) | 2700229..2701512 | - | 1284 | WP_262293047.1 | hypothetical protein | - |
N8E88_RS25635 (N8E88_25640) | 2701549..2701953 | + | 405 | WP_262293048.1 | hypothetical protein | - |
N8E88_RS25640 (N8E88_25645) | 2702172..2703155 | + | 984 | WP_262293049.1 | NAD(P)-dependent oxidoreductase | - |
N8E88_RS25645 (N8E88_25650) | 2703235..2703414 | + | 180 | WP_262293050.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
N8E88_RS25650 (N8E88_25655) | 2703463..2703858 | + | 396 | WP_262293051.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
N8E88_RS25655 (N8E88_25660) | 2704182..2704991 | + | 810 | WP_262293052.1 | VOC family protein | - |
N8E88_RS25660 (N8E88_25665) | 2705415..2706731 | - | 1317 | WP_262293053.1 | adenylosuccinate lyase | - |
N8E88_RS25665 (N8E88_25670) | 2706826..2707555 | - | 730 | Protein_2613 | DUF2259 domain-containing protein | - |
N8E88_RS25670 (N8E88_25675) | 2707552..2708229 | - | 678 | WP_262293054.1 | ribulose-phosphate 3-epimerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6597.65 Da Isoelectric Point: 10.4638
>T259544 WP_262293050.1 NZ_CP104973:2703235-2703414 [Phyllobacterium zundukense]
MPKPEIVARLEAEGWINVGGGNHDRFIHKDRPELMIPVPRHRELSPGTARSIAKAAGWM
MPKPEIVARLEAEGWINVGGGNHDRFIHKDRPELMIPVPRHRELSPGTARSIAKAAGWM
Download Length: 180 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 13368.28 Da Isoelectric Point: 4.4549
>AT259544 WP_262293051.1 NZ_CP104973:2703463-2703858 [Phyllobacterium zundukense]
MTYYVGILDGTGAVWGVRIPDVSGCVGAGASPEQAIADVTIALRDVMAHRRGGGFEIPAPSSVSAILASGEIQAGETIVM
IPLVLDSGRTVRANLTMDAGLLDAIDEAATLRGVTRSAFVASAAREKIEAA
MTYYVGILDGTGAVWGVRIPDVSGCVGAGASPEQAIADVTIALRDVMAHRRGGGFEIPAPSSVSAILASGEIQAGETIVM
IPLVLDSGRTVRANLTMDAGLLDAIDEAATLRGVTRSAFVASAAREKIEAA
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|