Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN-MazE
Location 2695838..2696462 Replicon chromosome
Accession NZ_CP104973
Organism Phyllobacterium zundukense strain A18/3m

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag N8E88_RS25595 Protein ID WP_262293042.1
Coordinates 2695838..2696242 (-) Length 135 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag N8E88_RS25600 Protein ID WP_262295624.1
Coordinates 2696232..2696462 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N8E88_RS25560 (N8E88_25565) 2691175..2691942 + 768 WP_262293036.1 SDR family oxidoreductase -
N8E88_RS25565 (N8E88_25570) 2692045..2692371 + 327 WP_114428873.1 DUF1330 domain-containing protein -
N8E88_RS25570 (N8E88_25575) 2692601..2694016 - 1416 WP_262293037.1 PLP-dependent aminotransferase family protein -
N8E88_RS25575 (N8E88_25580) 2694108..2694341 + 234 WP_262293038.1 DUF1127 domain-containing protein -
N8E88_RS25580 (N8E88_25585) 2694409..2694618 + 210 WP_262293039.1 DUF1127 domain-containing protein -
N8E88_RS25585 (N8E88_25590) 2694660..2695076 - 417 WP_262293040.1 hypothetical protein -
N8E88_RS25590 (N8E88_25595) 2695100..2695759 - 660 WP_262293041.1 glutathione S-transferase family protein -
N8E88_RS25595 (N8E88_25600) 2695838..2696242 - 405 WP_262293042.1 PIN domain-containing protein Toxin
N8E88_RS25600 (N8E88_25605) 2696232..2696462 - 231 WP_262295624.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
N8E88_RS25605 (N8E88_25610) 2696640..2697188 - 549 WP_262293043.1 alpha/beta hydrolase -
N8E88_RS25610 (N8E88_25615) 2697396..2698085 + 690 WP_262293044.1 mechanosensitive ion channel family protein -
N8E88_RS25615 (N8E88_25620) 2698133..2698831 + 699 WP_262293045.1 cyclic nucleotide-binding domain-containing protein -
N8E88_RS25620 (N8E88_25625) 2698920..2699579 + 660 WP_262293046.1 dihydrofolate reductase family protein -
N8E88_RS25625 (N8E88_25630) 2699620..2699973 - 354 WP_262295625.1 CAP-Gly domain protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-114)

Antitoxin

SpoVT-AbrB domain

(5-37)


Sequences

Toxin        


Download         Length: 135 a.a.        Molecular weight: 15137.51 Da        Isoelectric Point: 4.4285

>T259543 WP_262293042.1 NZ_CP104973:c2696242-2695838 [Phyllobacterium zundukense]
MPAEFLDTNVLIYAFTDDPRRIRSQELLAEGCTIGVQVLNEFTNVARRKLGMDWEEIREALASICTLCPKIVSMDVNVHE
EAIAIAERHGFQIFDALMIASAILSGCDVLWSEDMRDGLVIENRLRIVNPFRLA

Download         Length: 405 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8834.98 Da        Isoelectric Point: 5.8884

>AT259543 WP_262295624.1 NZ_CP104973:c2696462-2696232 [Phyllobacterium zundukense]
MRVAKWGNSLAIRLPATVVDALDLEEGTEIEIRVADERTFEIAHDRSRERALERIRAFGKKLPPDWKFDRDESNAR

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References