Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2231757..2232388 | Replicon | chromosome |
Accession | NZ_CP104973 | ||
Organism | Phyllobacterium zundukense strain A18/3m |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N8E88_RS23360 | Protein ID | WP_262292672.1 |
Coordinates | 2231757..2232155 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N8E88_RS23365 | Protein ID | WP_262292673.1 |
Coordinates | 2232155..2232388 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8E88_RS23340 (N8E88_23345) | 2227226..2228146 | - | 921 | WP_262292669.1 | LysR family transcriptional regulator | - |
N8E88_RS23345 (N8E88_23350) | 2228264..2229295 | + | 1032 | WP_262292670.1 | NAD(P)-dependent alcohol dehydrogenase | - |
N8E88_RS23350 (N8E88_23355) | 2229406..2229618 | - | 213 | WP_106718517.1 | cold-shock protein | - |
N8E88_RS23355 (N8E88_23360) | 2229952..2231736 | + | 1785 | WP_262292671.1 | ABC transporter ATP-binding protein/permease | - |
N8E88_RS23360 (N8E88_23365) | 2231757..2232155 | - | 399 | WP_262292672.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
N8E88_RS23365 (N8E88_23370) | 2232155..2232388 | - | 234 | WP_262292673.1 | antitoxin | Antitoxin |
N8E88_RS23370 (N8E88_23375) | 2232477..2235962 | - | 3486 | WP_262292674.1 | carbamoyl-phosphate synthase large subunit | - |
N8E88_RS23375 (N8E88_23380) | 2236290..2237219 | + | 930 | WP_262292675.1 | neutral zinc metallopeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14843.19 Da Isoelectric Point: 6.9576
>T259541 WP_262292672.1 NZ_CP104973:c2232155-2231757 [Phyllobacterium zundukense]
MLRYMLDTNICIYVMKSYPLQLREKFNALAEQLCISSITLGEMHYGTEKSARTVENLKAIEHFVSRLEVLPFAAGAAVHY
GQIRADLERAGTPCGSHDMQIGGHARSEGLVVVTNNMREFIRMPGVLTENWI
MLRYMLDTNICIYVMKSYPLQLREKFNALAEQLCISSITLGEMHYGTEKSARTVENLKAIEHFVSRLEVLPFAAGAAVHY
GQIRADLERAGTPCGSHDMQIGGHARSEGLVVVTNNMREFIRMPGVLTENWI
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|