Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 834306..834886 Replicon plasmid p_unnamed1
Accession NZ_CP104972
Organism Phyllobacterium zundukense strain A18/3m

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag N8E88_RS11615 Protein ID WP_106713775.1
Coordinates 834503..834886 (+) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag N8E88_RS11610 Protein ID WP_106667672.1
Coordinates 834306..834506 (+) Length 67 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N8E88_RS11575 (N8E88_11585) 829633..829804 - 172 Protein_828 outer membrane beta-barrel protein -
N8E88_RS11580 (N8E88_11590) 830447..830568 + 122 Protein_829 ATP-binding cassette domain-containing protein -
N8E88_RS11585 (N8E88_11595) 830919..831446 - 528 WP_262291860.1 cytochrome c -
N8E88_RS11590 (N8E88_11600) 831465..831695 - 231 WP_262291861.1 hypothetical protein -
N8E88_RS11595 (N8E88_11605) 831760..832002 - 243 WP_262291862.1 hypothetical protein -
N8E88_RS11600 832455..832676 - 222 WP_262291863.1 hypothetical protein -
N8E88_RS11605 (N8E88_11610) 832678..834117 + 1440 WP_262292419.1 PLP-dependent aminotransferase family protein -
N8E88_RS11610 (N8E88_11615) 834306..834506 + 201 WP_106667672.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N8E88_RS11615 (N8E88_11620) 834503..834886 + 384 WP_106713775.1 type II toxin-antitoxin system VapC family toxin Toxin
N8E88_RS11620 (N8E88_11625) 835374..836522 - 1149 WP_262291864.1 adenylate/guanylate cyclase domain-containing protein -
N8E88_RS11625 (N8E88_11630) 836762..837676 + 915 WP_262291865.1 DMT family transporter -
N8E88_RS11630 (N8E88_11635) 838042..838914 - 873 WP_262291866.1 SDR family NAD(P)-dependent oxidoreductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - flhA / fliQ / fliP / htpB 1..990469 990469


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-113)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14056.24 Da        Isoelectric Point: 7.0621

>T259539 WP_106713775.1 NZ_CP104972:834503-834886 [Phyllobacterium zundukense]
VILADTSIWIDHFRRVDAELRRIIEDDLLLCHPAVIGELALGSLRDRGSVIAFLAAQRAAVVATHDEVMTMIDRHSLFSI
GIGYTDAHLLASVLLDQRATLWTRDKRLRAAAEKAGASLHLPVNRPN

Download         Length: 384 bp

Antitoxin


Download         Length: 67 a.a.        Molecular weight: 7142.24 Da        Isoelectric Point: 10.9613

>AT259539 WP_106667672.1 NZ_CP104972:834306-834506 [Phyllobacterium zundukense]
MRSTINLDDTLMEKARFLTGTNETAALVRQALETLVRVESGKRLIALGGTMPDAEAAPRRRSAAAK

Download         Length: 201 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References