Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
Location | 754042..754589 | Replicon | plasmid p_unnamed1 |
Accession | NZ_CP104972 | ||
Organism | Phyllobacterium zundukense strain A18/3m |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | N8E88_RS11190 | Protein ID | WP_262291806.1 |
Coordinates | 754042..754335 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | N8E88_RS11195 | Protein ID | WP_262291807.1 |
Coordinates | 754335..754589 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8E88_RS11170 (N8E88_11180) | 751095..751568 | + | 474 | WP_262291802.1 | hypothetical protein | - |
N8E88_RS11175 (N8E88_11185) | 751619..751891 | + | 273 | WP_262291803.1 | hypothetical protein | - |
N8E88_RS11180 (N8E88_11190) | 752111..752695 | - | 585 | WP_262291804.1 | GNAT family N-acetyltransferase | - |
N8E88_RS11185 (N8E88_11195) | 753161..753691 | + | 531 | WP_262291805.1 | dihydrofolate reductase family protein | - |
N8E88_RS11190 (N8E88_11200) | 754042..754335 | - | 294 | WP_262291806.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N8E88_RS11195 (N8E88_11205) | 754335..754589 | - | 255 | WP_262291807.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
N8E88_RS11200 (N8E88_11210) | 754771..756048 | - | 1278 | WP_262291808.1 | adenylate/guanylate cyclase domain-containing protein | - |
N8E88_RS11205 (N8E88_11215) | 756593..756958 | + | 366 | WP_262291809.1 | MmcQ/YjbR family DNA-binding protein | - |
N8E88_RS11210 (N8E88_11220) | 757003..757222 | - | 220 | Protein_755 | antifreeze protein | - |
N8E88_RS11215 (N8E88_11225) | 757495..757620 | - | 126 | Protein_756 | SulP family inorganic anion transporter | - |
N8E88_RS11220 (N8E88_11230) | 757677..757931 | + | 255 | Protein_757 | SulP family inorganic anion transporter | - |
N8E88_RS11225 (N8E88_11235) | 758040..758645 | - | 606 | Protein_758 | protein-L-isoaspartate(D-aspartate) O-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | flhA / fliQ / fliP / htpB | 1..990469 | 990469 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11261.96 Da Isoelectric Point: 6.3280
>T259538 WP_262291806.1 NZ_CP104972:c754335-754042 [Phyllobacterium zundukense]
MRFSLSVEAEEDIIVITEQGIRMFGTLQARRYHDDLFAVLELIAANPRMAREREEISPPVRIHPFKAHLIVCRIQENGTI
FVIRIRHGHEDWASEPA
MRFSLSVEAEEDIIVITEQGIRMFGTLQARRYHDDLFAVLELIAANPRMAREREEISPPVRIHPFKAHLIVCRIQENGTI
FVIRIRHGHEDWASEPA
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|