Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 591973..592553 | Replicon | plasmid p_unnamed1 |
Accession | NZ_CP104972 | ||
Organism | Phyllobacterium zundukense strain A18/3m |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N8E88_RS10410 | Protein ID | WP_106713775.1 |
Coordinates | 592170..592553 (+) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N8E88_RS10405 | Protein ID | WP_106667672.1 |
Coordinates | 591973..592173 (+) | Length | 67 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8E88_RS10395 (N8E88_10405) | 588966..589742 | + | 777 | WP_262291683.1 | ATP-binding cassette domain-containing protein | - |
N8E88_RS10400 (N8E88_10410) | 590136..591166 | - | 1031 | Protein_593 | IS110 family transposase | - |
N8E88_RS10405 (N8E88_10415) | 591973..592173 | + | 201 | WP_106667672.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N8E88_RS10410 (N8E88_10420) | 592170..592553 | + | 384 | WP_106713775.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N8E88_RS10415 (N8E88_10425) | 593271..593534 | + | 264 | WP_262291684.1 | alpha-hydroxy-acid oxidizing protein | - |
N8E88_RS10420 (N8E88_10430) | 593711..594496 | - | 786 | WP_262291685.1 | DUF3313 domain-containing protein | - |
N8E88_RS10425 (N8E88_10435) | 594766..596097 | - | 1332 | WP_262291686.1 | HAMP domain-containing sensor histidine kinase | - |
N8E88_RS10430 (N8E88_10440) | 596103..596774 | - | 672 | WP_262292406.1 | response regulator transcription factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | flhA / fliQ / fliP / htpB | 1..990469 | 990469 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14056.24 Da Isoelectric Point: 7.0621
>T259537 WP_106713775.1 NZ_CP104972:592170-592553 [Phyllobacterium zundukense]
VILADTSIWIDHFRRVDAELRRIIEDDLLLCHPAVIGELALGSLRDRGSVIAFLAAQRAAVVATHDEVMTMIDRHSLFSI
GIGYTDAHLLASVLLDQRATLWTRDKRLRAAAEKAGASLHLPVNRPN
VILADTSIWIDHFRRVDAELRRIIEDDLLLCHPAVIGELALGSLRDRGSVIAFLAAQRAAVVATHDEVMTMIDRHSLFSI
GIGYTDAHLLASVLLDQRATLWTRDKRLRAAAEKAGASLHLPVNRPN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|