Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/CC2985(antitoxin)
Location 53267..53816 Replicon plasmid p_unnamed1
Accession NZ_CP104972
Organism Phyllobacterium zundukense strain A18/3m

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag N8E88_RS07725 Protein ID WP_262292371.1
Coordinates 53267..53488 (-) Length 74 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag N8E88_RS07730 Protein ID WP_262292011.1
Coordinates 53550..53816 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N8E88_RS07700 (N8E88_07710) 48806..50020 + 1215 WP_262292008.1 ROK family transcriptional regulator -
N8E88_RS07705 (N8E88_07715) 50090..51200 + 1111 Protein_55 Fic family protein -
N8E88_RS07710 (N8E88_07720) 51201..51788 - 588 WP_262292009.1 PAS and helix-turn-helix domain-containing protein -
N8E88_RS07715 (N8E88_07725) 51925..52590 + 666 WP_245426570.1 CoA transferase subunit A -
N8E88_RS07720 (N8E88_07730) 52592..53233 + 642 WP_262292010.1 3-oxoacid CoA-transferase subunit B -
N8E88_RS07725 (N8E88_07735) 53267..53488 - 222 WP_262292371.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N8E88_RS07730 (N8E88_07740) 53550..53816 - 267 WP_262292011.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
N8E88_RS07735 (N8E88_07745) 53901..54083 - 183 WP_114432617.1 hypothetical protein -
N8E88_RS07740 (N8E88_07750) 54350..54616 + 267 WP_112532543.1 helix-turn-helix transcriptional regulator -
N8E88_RS07745 (N8E88_07755) 54704..55537 - 834 WP_262292012.1 alpha/beta hydrolase -
N8E88_RS07750 (N8E88_07760) 55561..56472 - 912 WP_262292013.1 ABC transporter permease -
N8E88_RS07755 (N8E88_07765) 56477..57259 - 783 WP_262292372.1 ABC transporter ATP-binding protein -
N8E88_RS07760 (N8E88_07770) 57411..58385 - 975 WP_262292014.1 ABC transporter substrate-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - flhA / fliQ / fliP / htpB 1..990469 990469


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-66)

Antitoxin

Antitoxin ParD

(5-73)


Sequences

Toxin        


Download         Length: 74 a.a.        Molecular weight: 8345.74 Da        Isoelectric Point: 9.6576

>T259535 WP_262292371.1 NZ_CP104972:c53488-53267 [Phyllobacterium zundukense]
MFGVIQARRYKDELDYCFKLLADTPHMGRLAETLGSGVRRHEHKSHVILYEQEANGILVLALVPGRSVRQLKL

Download         Length: 222 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9954.18 Da        Isoelectric Point: 6.3518

>AT259535 WP_262292011.1 NZ_CP104972:c53816-53550 [Phyllobacterium zundukense]
MATMTVSLPDQMKDWIETQIRKGEYASTSDYVRDLVRRDRSRRGKEFTLDELRQLVADAKASGVGTRSMDDIFAQAEQIA
SARGLGRE

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References