Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-VagC |
Location | 536988..537652 | Replicon | plasmid p_unnamed2 |
Accession | NZ_CP104971 | ||
Organism | Phyllobacterium zundukense strain A18/3m |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N8E88_RS07205 | Protein ID | WP_262291297.1 |
Coordinates | 537260..537652 (+) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N8E88_RS07200 | Protein ID | WP_262291296.1 |
Coordinates | 536988..537248 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8E88_RS07170 (N8E88_07180) | 532296..532520 | + | 225 | WP_114431013.1 | hypothetical protein | - |
N8E88_RS07175 (N8E88_07185) | 532579..533373 | + | 795 | WP_262291291.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
N8E88_RS07180 (N8E88_07190) | 533401..534039 | - | 639 | WP_262291292.1 | maleylacetoacetate isomerase | - |
N8E88_RS07185 (N8E88_07195) | 534036..535055 | - | 1020 | WP_262291293.1 | fumarylacetoacetate hydrolase family protein | - |
N8E88_RS07190 (N8E88_07200) | 535052..536386 | - | 1335 | WP_262291294.1 | homogentisate 1,2-dioxygenase | - |
N8E88_RS07195 (N8E88_07205) | 536469..536921 | + | 453 | WP_262291295.1 | MarR family transcriptional regulator | - |
N8E88_RS07200 (N8E88_07210) | 536988..537248 | + | 261 | WP_262291296.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
N8E88_RS07205 (N8E88_07215) | 537260..537652 | + | 393 | WP_262291297.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N8E88_RS07210 (N8E88_07220) | 537649..538410 | - | 762 | WP_114431006.1 | ABC transporter permease | - |
N8E88_RS07215 (N8E88_07225) | 538407..539333 | - | 927 | WP_262291298.1 | ABC transporter ATP-binding protein | - |
N8E88_RS07220 (N8E88_07230) | 539531..540751 | - | 1221 | WP_262291299.1 | MFS transporter | - |
N8E88_RS07225 (N8E88_07235) | 540881..541708 | + | 828 | WP_262291300.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..586768 | 586768 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 13970.28 Da Isoelectric Point: 9.1231
>T259534 WP_262291297.1 NZ_CP104971:537260-537652 [Phyllobacterium zundukense]
MLDTNAVSLAIKGNAATVKRMVDIPMASICISVVTEAELLFGLAKRPAATKLSSRIHEFLKRVNSLPLDSTVAARYGPLR
AQLEQRGRAIIGLDLLIAAHAIAANAILVSNDAAFRHVEGLQVEDWSKDP
MLDTNAVSLAIKGNAATVKRMVDIPMASICISVVTEAELLFGLAKRPAATKLSSRIHEFLKRVNSLPLDSTVAARYGPLR
AQLEQRGRAIIGLDLLIAAHAIAANAILVSNDAAFRHVEGLQVEDWSKDP
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|