Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 904215..904795 Replicon plasmid p_unnamed1
Accession NZ_CP104967
Organism Phyllobacterium sp. A18/5-2

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag N8E89_RS22945 Protein ID WP_262262116.1
Coordinates 904215..904598 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag N8E89_RS22950 Protein ID WP_262262117.1
Coordinates 904595..904795 (-) Length 67 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N8E89_RS22915 (N8E89_22910) 899490..899666 - 177 WP_262262108.1 hypothetical protein -
N8E89_RS22920 (N8E89_22915) 899730..900041 - 312 WP_262262110.1 thermonuclease family protein -
N8E89_RS22925 (N8E89_22920) 900247..901263 - 1017 WP_262262112.1 histidine kinase dimerization/phosphoacceptor domain -containing protein -
N8E89_RS22930 (N8E89_22925) 901545..901781 - 237 WP_262262114.1 hypothetical protein -
N8E89_RS22935 (N8E89_22930) 901805..902170 - 366 WP_262262115.1 hypothetical protein -
N8E89_RS22940 (N8E89_22935) 902975..904002 - 1028 Protein_900 IS110 family transposase -
N8E89_RS22945 (N8E89_22940) 904215..904598 - 384 WP_262262116.1 type II toxin-antitoxin system VapC family toxin Toxin
N8E89_RS22950 (N8E89_22945) 904595..904795 - 201 WP_262262117.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N8E89_RS22955 (N8E89_22950) 905604..905766 - 163 Protein_903 winged helix-turn-helix transcriptional regulator -
N8E89_RS22960 (N8E89_22955) 905972..906565 - 594 WP_262262118.1 TetR/AcrR family transcriptional regulator -
N8E89_RS22965 (N8E89_22960) 906664..907776 + 1113 WP_262262119.1 efflux RND transporter periplasmic adaptor subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - fliP / flgI / fliI / motA / gmd / htpB / flhA / fliQ 1..1594332 1594332


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 13936.11 Da        Isoelectric Point: 7.4770

>T259532 WP_262262116.1 NZ_CP104967:c904598-904215 [Phyllobacterium sp. A18/5-2]
VILADTSIWIDHFRRVDAELRRIIEDDLLLCHPAVFGELALGSLGARGSVMAFLAAQRAAVAATHDEVMTMINRHSLFSI
GIGYTDAHLLASVLLDQRATLWTRDKRLRAAAEKAGASLHLPVNRPN

Download         Length: 384 bp

Antitoxin


Download         Length: 67 a.a.        Molecular weight: 7108.23 Da        Isoelectric Point: 10.9613

>AT259532 WP_262262117.1 NZ_CP104967:c904795-904595 [Phyllobacterium sp. A18/5-2]
MRSTINLDDTLMEKARLLTGTNETAALVRQALETLVRVESGKRLIALGGTMPDAEAAPRRRSAAAK

Download         Length: 201 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References