Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 650967..651643 | Replicon | plasmid p_unnamed1 |
Accession | NZ_CP104967 | ||
Organism | Phyllobacterium sp. A18/5-2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N8E89_RS21675 | Protein ID | WP_262263166.1 |
Coordinates | 651218..651643 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N8E89_RS21670 | Protein ID | WP_262263165.1 |
Coordinates | 650967..651221 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8E89_RS21640 (N8E89_21635) | 646182..647105 | - | 924 | WP_262263163.1 | glyoxylate/hydroxypyruvate reductase A | - |
N8E89_RS21645 (N8E89_21640) | 647164..648290 | - | 1127 | Protein_641 | acetylornithine deacetylase | - |
N8E89_RS21650 (N8E89_21645) | 648558..649448 | + | 891 | WP_262263164.1 | GNAT family N-acetyltransferase | - |
N8E89_RS21655 (N8E89_21650) | 649572..650436 | - | 865 | Protein_643 | alpha/beta fold hydrolase | - |
N8E89_RS21660 (N8E89_21655) | 650616..650764 | - | 149 | Protein_644 | RES domain-containing protein | - |
N8E89_RS21665 (N8E89_21660) | 650766..650864 | - | 99 | Protein_645 | recombinase family protein | - |
N8E89_RS21670 (N8E89_21665) | 650967..651221 | + | 255 | WP_262263165.1 | plasmid stability protein stbC | Antitoxin |
N8E89_RS21675 (N8E89_21670) | 651218..651643 | + | 426 | WP_262263166.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N8E89_RS21680 (N8E89_21675) | 651832..652908 | - | 1077 | WP_262263167.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
N8E89_RS21685 (N8E89_21680) | 652905..653837 | - | 933 | WP_262263168.1 | PfkB family carbohydrate kinase | - |
N8E89_RS21690 (N8E89_21685) | 653837..654853 | - | 1017 | WP_262263169.1 | SIS domain-containing protein | - |
N8E89_RS21695 (N8E89_21690) | 654861..655705 | - | 845 | Protein_651 | carbohydrate ABC transporter permease | - |
N8E89_RS21700 (N8E89_21695) | 655705..656586 | - | 882 | WP_262263170.1 | sugar ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | fliP / flgI / fliI / motA / gmd / htpB / flhA / fliQ | 1..1594332 | 1594332 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15122.28 Da Isoelectric Point: 4.4227
>T259530 WP_262263166.1 NZ_CP104967:651218-651643 [Phyllobacterium sp. A18/5-2]
MILIDTNVISEPWRLTPDARVLAWIDAQAIETLYLSAVTIAEVGFGIASMPAGKRRTTLHDRLENEVLPLFEGRLLPFDL
DASQAYADLMAQAKAAGRAIGKADGYIAATAAAHGLMVATRDTSPFEAAGVPIINPWETSD
MILIDTNVISEPWRLTPDARVLAWIDAQAIETLYLSAVTIAEVGFGIASMPAGKRRTTLHDRLENEVLPLFEGRLLPFDL
DASQAYADLMAQAKAAGRAIGKADGYIAATAAAHGLMVATRDTSPFEAAGVPIINPWETSD
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|