Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 2794041..2794651 | Replicon | chromosome |
| Accession | NZ_CP104966 | ||
| Organism | Phyllobacterium sp. A18/5-2 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | N8E89_RS13920 | Protein ID | WP_106664813.1 |
| Coordinates | 2794041..2794349 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | N8E89_RS13925 | Protein ID | WP_245448832.1 |
| Coordinates | 2794397..2794651 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8E89_RS13900 (N8E89_13895) | 2789198..2790058 | - | 861 | WP_106664807.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ | - |
| N8E89_RS13905 (N8E89_13900) | 2790221..2791063 | + | 843 | WP_262260247.1 | EamA family transporter | - |
| N8E89_RS13910 (N8E89_13905) | 2791065..2791712 | - | 648 | WP_106664811.1 | glutathione S-transferase family protein | - |
| N8E89_RS13915 (N8E89_13910) | 2791861..2793972 | + | 2112 | WP_262260249.1 | molybdopterin oxidoreductase family protein | - |
| N8E89_RS13920 (N8E89_13915) | 2794041..2794349 | + | 309 | WP_106664813.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N8E89_RS13925 (N8E89_13920) | 2794397..2794651 | + | 255 | WP_245448832.1 | putative addiction module antidote protein | Antitoxin |
| N8E89_RS13930 (N8E89_13925) | 2794670..2795233 | - | 564 | WP_106664995.1 | phosphoribosylglycinamide formyltransferase | - |
| N8E89_RS13935 (N8E89_13930) | 2795290..2796375 | - | 1086 | WP_112760828.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| N8E89_RS13940 (N8E89_13935) | 2796559..2797100 | + | 542 | Protein_2747 | CDP-alcohol phosphatidyltransferase family protein | - |
| N8E89_RS13945 (N8E89_13940) | 2797168..2798280 | + | 1113 | WP_162707280.1 | AI-2E family transporter | - |
| N8E89_RS13950 (N8E89_13945) | 2798314..2798995 | + | 682 | Protein_2749 | DnaA regulatory inactivator HdaA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11634.41 Da Isoelectric Point: 9.0575
>T259527 WP_106664813.1 NZ_CP104966:2794041-2794349 [Phyllobacterium sp. A18/5-2]
MNYSIEKTDTFLNWIEGLQDLRARARIMSRLDRLADGNFGDYKLLGEDVGEMRIDCGPGYRLYFTKQGGILIILLCGGDK
STQSRDIRKAKAMARDLKEIRS
MNYSIEKTDTFLNWIEGLQDLRARARIMSRLDRLADGNFGDYKLLGEDVGEMRIDCGPGYRLYFTKQGGILIILLCGGDK
STQSRDIRKAKAMARDLKEIRS
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|