Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 2596137..2596704 | Replicon | chromosome |
Accession | NZ_CP104966 | ||
Organism | Phyllobacterium sp. A18/5-2 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | N8E89_RS12865 | Protein ID | WP_106667239.1 |
Coordinates | 2596137..2596412 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N8E89_RS12870 | Protein ID | WP_106667240.1 |
Coordinates | 2596399..2596704 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8E89_RS12855 (N8E89_12850) | 2591762..2593191 | + | 1430 | Protein_2531 | HAMP domain-containing histidine kinase | - |
N8E89_RS12860 (N8E89_12855) | 2593160..2596125 | + | 2966 | Protein_2532 | bifunctional [glutamine synthetase] adenylyltransferase/[glutamine synthetase]-adenylyl-L-tyrosine phosphorylase | - |
N8E89_RS12865 (N8E89_12860) | 2596137..2596412 | - | 276 | WP_106667239.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N8E89_RS12870 (N8E89_12865) | 2596399..2596704 | - | 306 | WP_106667240.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N8E89_RS12875 (N8E89_12870) | 2596772..2599105 | - | 2334 | WP_106667241.1 | PAS domain-containing sensor histidine kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10407.16 Da Isoelectric Point: 7.9936
>T259526 WP_106667239.1 NZ_CP104966:c2596412-2596137 [Phyllobacterium sp. A18/5-2]
VPVLEWRETARADLLAIMDYISDDSPAAAQQLKNEIEMKVLNLLKYPRSCKLGRVPGTREMIVRANYILIYTENVQAVSI
LRVLHAAQQWP
VPVLEWRETARADLLAIMDYISDDSPAAAQQLKNEIEMKVLNLLKYPRSCKLGRVPGTREMIVRANYILIYTENVQAVSI
LRVLHAAQQWP
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|