Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
Location | 1725526..1726217 | Replicon | chromosome |
Accession | NZ_CP104965 | ||
Organism | Devosia neptuniae strain A18/4-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N8A98_RS11305 | Protein ID | WP_262171415.1 |
Coordinates | 1725786..1726217 (+) | Length | 144 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N8A98_RS11300 | Protein ID | WP_262171413.1 |
Coordinates | 1725526..1725789 (+) | Length | 88 a.a. |
Genomic Context
Location: 1722817..1723293 (477 bp)
Type: Others
Protein ID: WP_262171408.1
Type: Others
Protein ID: WP_262171408.1
Location: 1723322..1724176 (855 bp)
Type: Others
Protein ID: WP_262171410.1
Type: Others
Protein ID: WP_262171410.1
Location: 1724261..1724653 (393 bp)
Type: Others
Protein ID: WP_262171411.1
Type: Others
Protein ID: WP_262171411.1
Location: 1724750..1725372 (623 bp)
Type: Others
Protein ID: Protein_1737
Type: Others
Protein ID: Protein_1737
Location: 1725526..1725789 (264 bp)
Type: Antitoxin
Protein ID: WP_262171413.1
Type: Antitoxin
Protein ID: WP_262171413.1
Location: 1725786..1726217 (432 bp)
Type: Toxin
Protein ID: WP_262171415.1
Type: Toxin
Protein ID: WP_262171415.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8A98_RS11280 (N8A98_11280) | 1722817..1723293 | + | 477 | WP_262171408.1 | GNAT family protein | - |
N8A98_RS11285 (N8A98_11285) | 1723322..1724176 | + | 855 | WP_262171410.1 | aminoglycoside phosphotransferase family protein | - |
N8A98_RS11290 (N8A98_11290) | 1724261..1724653 | + | 393 | WP_262171411.1 | DUF4440 domain-containing protein | - |
N8A98_RS11295 (N8A98_11295) | 1724750..1725372 | + | 623 | Protein_1737 | glycerol-3-phosphate 1-O-acyltransferase PlsY | - |
N8A98_RS11300 (N8A98_11300) | 1725526..1725789 | + | 264 | WP_262171413.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N8A98_RS11305 (N8A98_11305) | 1725786..1726217 | + | 432 | WP_262171415.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 16059.49 Da Isoelectric Point: 4.3576
>T259523 WP_262171415.1 NZ_CP104965:1725786-1726217 [Devosia neptuniae]
VSFLLDTNVLSEIRRPQPDQQVLTWLDQVDEDRTYLSVITIAEIARGVALMDDGRRRNELAQWLELDLPARFGDRILPVD
TQIALIWGKLLASTRKEGIGLSVMDGWIAATAIALQLVLVTRNTRDFENLPLTLLDPWSPPAA
VSFLLDTNVLSEIRRPQPDQQVLTWLDQVDEDRTYLSVITIAEIARGVALMDDGRRRNELAQWLELDLPARFGDRILPVD
TQIALIWGKLLASTRKEGIGLSVMDGWIAATAIALQLVLVTRNTRDFENLPLTLLDPWSPPAA
Download Length: 432 bp