Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 340060..340824 | Replicon | plasmid p_unnamed1 |
Accession | NZ_CP104964 | ||
Organism | Devosia neptuniae strain A18/4-1 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | N8A98_RS01620 | Protein ID | WP_262165250.1 |
Coordinates | 340351..340824 (+) | Length | 158 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | N8A98_RS01615 | Protein ID | WP_113123739.1 |
Coordinates | 340060..340347 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8A98_RS01595 (N8A98_01595) | 335072..336094 | + | 1023 | WP_262165243.1 | hydroxyacid dehydrogenase | - |
N8A98_RS01600 (N8A98_01600) | 336091..336870 | + | 780 | WP_262165244.1 | sugar phosphate isomerase/epimerase | - |
N8A98_RS01605 (N8A98_01605) | 336885..338132 | + | 1248 | WP_262165246.1 | glucarate dehydratase family protein | - |
N8A98_RS01610 (N8A98_01610) | 338153..338893 | + | 741 | WP_262165247.1 | ribonuclease activity regulator RraA | - |
N8A98_RS01615 (N8A98_01615) | 340060..340347 | + | 288 | WP_113123739.1 | DUF1778 domain-containing protein | Antitoxin |
N8A98_RS01620 (N8A98_01620) | 340351..340824 | + | 474 | WP_262165250.1 | GNAT family N-acetyltransferase | Toxin |
N8A98_RS01625 (N8A98_01625) | 340910..341164 | + | 255 | WP_162740478.1 | hypothetical protein | - |
N8A98_RS01630 (N8A98_01630) | 341229..341708 | - | 480 | WP_262165253.1 | hypothetical protein | - |
N8A98_RS01635 (N8A98_01635) | 341902..342168 | - | 267 | WP_262165254.1 | hypothetical protein | - |
N8A98_RS01640 (N8A98_01640) | 342203..342574 | - | 372 | WP_262165256.1 | hypothetical protein | - |
N8A98_RS01645 (N8A98_01645) | 342764..345502 | + | 2739 | WP_262165257.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..532786 | 532786 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 158 a.a. Molecular weight: 17132.82 Da Isoelectric Point: 9.7521
>T259520 WP_262165250.1 NZ_CP104964:340351-340824 [Devosia neptuniae]
MQAPSRLSEQHRLEDFSSGEVVLDTWLKTRALPNQAAGVSRTYVAVEGGQVAGYYCLSSAAISLKEAPRALRHGMPDPLP
MILMGRLAVDQRYKGQGLGTALLKDSVLRAQSALEIIGVRGLLVHALHDQAKGFYLHHGFRETPGNPLTLVLPFKFT
MQAPSRLSEQHRLEDFSSGEVVLDTWLKTRALPNQAAGVSRTYVAVEGGQVAGYYCLSSAAISLKEAPRALRHGMPDPLP
MILMGRLAVDQRYKGQGLGTALLKDSVLRAQSALEIIGVRGLLVHALHDQAKGFYLHHGFRETPGNPLTLVLPFKFT
Download Length: 474 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|