Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /RES-Xre |
Location | 167701..168589 | Replicon | plasmid p_unnamed1 |
Accession | NZ_CP104964 | ||
Organism | Devosia neptuniae strain A18/4-1 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | N8A98_RS00830 | Protein ID | WP_262165727.1 |
Coordinates | 168065..168589 (+) | Length | 175 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | N8A98_RS00825 | Protein ID | WP_262165725.1 |
Coordinates | 167701..168072 (+) | Length | 124 a.a. |
Genomic Context
Location: 166880..167239 (360 bp)
Type: Others
Protein ID: WP_262165724.1
Type: Others
Protein ID: WP_262165724.1
Location: 167701..168072 (372 bp)
Type: Antitoxin
Protein ID: WP_262165725.1
Type: Antitoxin
Protein ID: WP_262165725.1
Location: 168065..168589 (525 bp)
Type: Toxin
Protein ID: WP_262165727.1
Type: Toxin
Protein ID: WP_262165727.1
Location: 170676..170893 (218 bp)
Type: Others
Protein ID: Protein_168
Type: Others
Protein ID: Protein_168
Location: 171442..172611 (1170 bp)
Type: Others
Protein ID: WP_262165731.1
Type: Others
Protein ID: WP_262165731.1
Location: 162904..164493 (1590 bp)
Type: Others
Protein ID: WP_262165907.1
Type: Others
Protein ID: WP_262165907.1
Location: 164656..165630 (975 bp)
Type: Others
Protein ID: WP_262165721.1
Type: Others
Protein ID: WP_262165721.1
Location: 165884..166762 (879 bp)
Type: Others
Protein ID: WP_262165722.1
Type: Others
Protein ID: WP_262165722.1
Location: 169121..169861 (741 bp)
Type: Others
Protein ID: WP_262165729.1
Type: Others
Protein ID: WP_262165729.1
Location: 169958..170542 (585 bp)
Type: Others
Protein ID: WP_262165730.1
Type: Others
Protein ID: WP_262165730.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8A98_RS00805 (N8A98_00805) | 162904..164493 | - | 1590 | WP_262165907.1 | iron ABC transporter permease | - |
N8A98_RS00810 (N8A98_00810) | 164656..165630 | - | 975 | WP_262165721.1 | ABC transporter substrate-binding protein | - |
N8A98_RS00815 (N8A98_00815) | 165884..166762 | - | 879 | WP_262165722.1 | NAD(P)H-binding protein | - |
N8A98_RS00820 (N8A98_00820) | 166880..167239 | + | 360 | WP_262165724.1 | helix-turn-helix domain-containing protein | - |
N8A98_RS00825 (N8A98_00825) | 167701..168072 | + | 372 | WP_262165725.1 | DUF2384 domain-containing protein | Antitoxin |
N8A98_RS00830 (N8A98_00830) | 168065..168589 | + | 525 | WP_262165727.1 | RES domain-containing protein | Toxin |
N8A98_RS00835 (N8A98_00835) | 169121..169861 | - | 741 | WP_262165729.1 | SDR family oxidoreductase | - |
N8A98_RS00840 (N8A98_00840) | 169958..170542 | - | 585 | WP_262165730.1 | TetR/AcrR family transcriptional regulator | - |
N8A98_RS00845 (N8A98_00845) | 170676..170893 | + | 218 | Protein_168 | hypothetical protein | - |
N8A98_RS00850 (N8A98_00850) | 171442..172611 | + | 1170 | WP_262165731.1 | GGDEF domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..532786 | 532786 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 175 a.a. Molecular weight: 19332.75 Da Isoelectric Point: 4.7881
>T259519 WP_262165727.1 NZ_CP104964:168065-168589 [Devosia neptuniae]
MPELVDTKPFILWRAYVPQWSYLPLSGEGAARFGGRWNPVGIPTIYAAQELSTAWGEYNQGFVQHPALIAQLELKGARLV
DTRDPEILQEWGLEEGIHQSEWRSDLDNGAVPSTHDAHRRFVEGGLDGVIYPSFMSPGGSCVALWRWNDAGGPILNIIDP
DGRLPTSPASWRKP
MPELVDTKPFILWRAYVPQWSYLPLSGEGAARFGGRWNPVGIPTIYAAQELSTAWGEYNQGFVQHPALIAQLELKGARLV
DTRDPEILQEWGLEEGIHQSEWRSDLDNGAVPSTHDAHRRFVEGGLDGVIYPSFMSPGGSCVALWRWNDAGGPILNIIDP
DGRLPTSPASWRKP
Download Length: 525 bp
Antitoxin
Download Length: 124 a.a. Molecular weight: 13055.98 Da Isoelectric Point: 9.9495
>AT259519 WP_262165725.1 NZ_CP104964:167701-168072 [Devosia neptuniae]
MQSQGLEIGATRFGESGSPFLSAHRLSEQLGVTQSELAKLIGIARNTLTAKSATRKVDAALSPIVRILAMAAEMAGGENR
AVIWFKHQPIPGWAGKTAYDLVGQGKSDQVLAYLEAVRSGVYA
MQSQGLEIGATRFGESGSPFLSAHRLSEQLGVTQSELAKLIGIARNTLTAKSATRKVDAALSPIVRILAMAAEMAGGENR
AVIWFKHQPIPGWAGKTAYDLVGQGKSDQVLAYLEAVRSGVYA
Download Length: 372 bp