Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 24525..25261 | Replicon | plasmid pHNAH8130-1 |
Accession | NZ_CP104927 | ||
Organism | Klebsiella pasteurii strain AHM8C130-1I |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | N5863_RS29110 | Protein ID | WP_284659185.1 |
Coordinates | 24779..25261 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | N5863_RS29105 | Protein ID | WP_284659184.1 |
Coordinates | 24525..24791 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5863_RS29075 (N5863_29070) | 20108..21255 | + | 1148 | WP_284659196.1 | IS3 family transposase | - |
N5863_RS29080 (N5863_29075) | 21299..21862 | + | 564 | WP_284659181.1 | LuxR C-terminal-related transcriptional regulator | - |
N5863_RS29085 (N5863_29080) | 21974..22459 | - | 486 | WP_284659182.1 | hypothetical protein | - |
N5863_RS29090 (N5863_29085) | 22449..23180 | - | 732 | WP_284659183.1 | winged helix-turn-helix domain-containing protein | - |
N5863_RS29095 (N5863_29090) | 23631..24170 | + | 540 | Protein_22 | hypothetical protein | - |
N5863_RS29100 (N5863_29095) | 24195..24452 | + | 258 | WP_284659201.1 | hypothetical protein | - |
N5863_RS29105 (N5863_29100) | 24525..24791 | + | 267 | WP_284659184.1 | DUF1778 domain-containing protein | Antitoxin |
N5863_RS29110 (N5863_29105) | 24779..25261 | + | 483 | WP_284659185.1 | GNAT family N-acetyltransferase | Toxin |
N5863_RS29115 (N5863_29110) | 25613..28564 | + | 2952 | WP_050484548.1 | hypothetical protein | - |
N5863_RS29120 (N5863_29115) | 28548..29000 | + | 453 | WP_072023797.1 | response regulator | - |
N5863_RS29125 (N5863_29120) | 28997..30157 | + | 1161 | WP_110183785.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..92922 | 92922 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17374.10 Da Isoelectric Point: 8.3151
>T259518 WP_284659185.1 NZ_CP104927:24779-25261 [Klebsiella pasteurii]
MGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCNTGTKHVAGFYSLATGSVNHTEATGSLRRNM
PEPIPVIILARLAVDVSLLGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHRFMASQTHERTLFLKLP
MGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCNTGTKHVAGFYSLATGSVNHTEATGSLRRNM
PEPIPVIILARLAVDVSLLGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHRFMASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|