Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prpT-prpA/ParE-CC2985 |
Location | 2811..3360 | Replicon | plasmid pHNAH8130-1 |
Accession | NZ_CP104927 | ||
Organism | Klebsiella pasteurii strain AHM8C130-1I |
Toxin (Protein)
Gene name | PrpT | Uniprot ID | - |
Locus tag | N5863_RS28995 | Protein ID | WP_284659166.1 |
Coordinates | 2811..3107 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | PrpA | Uniprot ID | - |
Locus tag | N5863_RS29000 | Protein ID | WP_284659167.1 |
Coordinates | 3094..3360 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5863_RS28985 (N5863_28980) | 1..1011 | + | 1011 | WP_000200070.1 | RepB family plasmid replication initiator protein | - |
N5863_RS28990 (N5863_28985) | 1709..2449 | - | 741 | WP_284659165.1 | tyrosine-type recombinase/integrase | - |
N5863_RS28995 (N5863_28990) | 2811..3107 | - | 297 | WP_284659166.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5863_RS29000 (N5863_28995) | 3094..3360 | - | 267 | WP_284659167.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
N5863_RS29005 (N5863_29000) | 3571..3959 | - | 389 | Protein_4 | transposase | - |
N5863_RS29010 (N5863_29005) | 4326..5243 | + | 918 | WP_284659168.1 | winged helix-turn-helix domain-containing protein | - |
N5863_RS29015 (N5863_29010) | 5377..5940 | + | 564 | WP_284659169.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..92922 | 92922 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11499.01 Da Isoelectric Point: 6.3699
>T259517 WP_284659166.1 NZ_CP104927:c3107-2811 [Klebsiella pasteurii]
VKTVKLTPKASQDLEDIWYYGYHHFGEEQADKYINQISDIFQVVSDHNIGTPRPQLGEHICALPVERHMIYFLQTDTEIV
IIRILSQHQDAGRHLNWK
VKTVKLTPKASQDLEDIWYYGYHHFGEEQADKYINQISDIFQVVSDHNIGTPRPQLGEHICALPVERHMIYFLQTDTEIV
IIRILSQHQDAGRHLNWK
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|