Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ypjF-yeeU/CbtA-CbeA |
Location | 4772641..4773358 | Replicon | chromosome |
Accession | NZ_CP104925 | ||
Organism | Klebsiella pasteurii strain AHM8C130-1I |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | N5863_RS22520 | Protein ID | WP_071994601.1 |
Coordinates | 4773026..4773358 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A8B4G4X8 |
Locus tag | N5863_RS22515 | Protein ID | WP_032410127.1 |
Coordinates | 4772641..4772991 (+) | Length | 117 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5863_RS22485 (N5863_22480) | 4767818..4768969 | - | 1152 | WP_284658635.1 | hypothetical protein | - |
N5863_RS22490 (N5863_22485) | 4769067..4769960 | + | 894 | WP_032410131.1 | 50S ribosome-binding GTPase | - |
N5863_RS22495 (N5863_22490) | 4770245..4770922 | + | 678 | WP_032410130.1 | hypothetical protein | - |
N5863_RS22500 (N5863_22495) | 4771018..4771839 | + | 822 | WP_162897387.1 | DUF932 domain-containing protein | - |
N5863_RS22505 (N5863_22500) | 4771910..4772383 | + | 474 | WP_032410128.1 | DNA repair protein RadC | - |
N5863_RS22510 (N5863_22505) | 4772399..4772620 | + | 222 | WP_004129348.1 | DUF987 domain-containing protein | - |
N5863_RS22515 (N5863_22510) | 4772641..4772991 | + | 351 | WP_032410127.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
N5863_RS22520 (N5863_22515) | 4773026..4773358 | + | 333 | WP_071994601.1 | TA system toxin CbtA family protein | Toxin |
N5863_RS22525 (N5863_22520) | 4773739..4774065 | + | 327 | Protein_4429 | Arm DNA-binding domain-containing protein | - |
N5863_RS22530 (N5863_22525) | 4774089..4774622 | + | 534 | Protein_4430 | IS3 family transposase | - |
N5863_RS22535 (N5863_22530) | 4774655..4776265 | - | 1611 | WP_227631513.1 | alpha/beta hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4748954..4776265 | 27311 | |
- | flank | IS/Tn | - | - | 4774257..4774622 | 365 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12513.46 Da Isoelectric Point: 7.2132
>T259514 WP_071994601.1 NZ_CP104925:4773026-4773358 [Klebsiella pasteurii]
MNTLPAINQRAVQTCLSPVVVWQMLLARLLEQHYGLTLNDTPFSDEAVLKRHIEAGITLVDAVNFLVEKYELIRIDRRGF
SSQGQVPYLTVTDILHARRECGLTNSCPYR
MNTLPAINQRAVQTCLSPVVVWQMLLARLLEQHYGLTLNDTPFSDEAVLKRHIEAGITLVDAVNFLVEKYELIRIDRRGF
SSQGQVPYLTVTDILHARRECGLTNSCPYR
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|