Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4535466..4536085 Replicon chromosome
Accession NZ_CP104925
Organism Klebsiella pasteurii strain AHM8C130-1I

Toxin (Protein)


Gene name Hha Uniprot ID H3N9D8
Locus tag N5863_RS21390 Protein ID WP_004099646.1
Coordinates 4535867..4536085 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID H3N7X7
Locus tag N5863_RS21385 Protein ID WP_004129911.1
Coordinates 4535466..4535840 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5863_RS21375 (N5863_21370) 4530636..4531829 + 1194 WP_004129915.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
N5863_RS21380 (N5863_21375) 4531852..4534998 + 3147 WP_004129913.1 multidrug efflux RND transporter permease subunit AcrB -
N5863_RS21385 (N5863_21380) 4535466..4535840 + 375 WP_004129911.1 Hha toxicity modulator TomB Antitoxin
N5863_RS21390 (N5863_21385) 4535867..4536085 + 219 WP_004099646.1 HHA domain-containing protein Toxin
N5863_RS21395 (N5863_21390) 4536247..4536813 + 567 WP_049114562.1 maltose O-acetyltransferase -
N5863_RS21400 (N5863_21395) 4536785..4536919 - 135 WP_224326009.1 hypothetical protein -
N5863_RS21405 (N5863_21400) 4536940..4537410 + 471 WP_004129906.1 YlaC family protein -
N5863_RS21410 (N5863_21405) 4537385..4538839 - 1455 WP_049114563.1 PLP-dependent aminotransferase family protein -
N5863_RS21415 (N5863_21410) 4538939..4539637 + 699 WP_049114564.1 GNAT family protein -
N5863_RS21420 (N5863_21415) 4539634..4539774 - 141 WP_003859006.1 type B 50S ribosomal protein L36 -
N5863_RS21425 (N5863_21420) 4539774..4540037 - 264 WP_004129897.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8640.05 Da        Isoelectric Point: 8.9008

>T259513 WP_004099646.1 NZ_CP104925:4535867-4536085 [Klebsiella pasteurii]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14350.09 Da        Isoelectric Point: 4.8989

>AT259513 WP_004129911.1 NZ_CP104925:4535466-4535840 [Klebsiella pasteurii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3H713

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3HD25

References