Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 884271..884928 | Replicon | chromosome |
Accession | NZ_CP104925 | ||
Organism | Klebsiella pasteurii strain AHM8C130-1I |
Toxin (Protein)
Gene name | cptA | Uniprot ID | H3N294 |
Locus tag | N5863_RS04245 | Protein ID | WP_004124948.1 |
Coordinates | 884518..884928 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | H3N295 |
Locus tag | N5863_RS04240 | Protein ID | WP_004124953.1 |
Coordinates | 884271..884537 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5863_RS04225 (N5863_04225) | 879526..879951 | - | 426 | WP_004124962.1 | PTS sugar transporter subunit IIA | - |
N5863_RS04230 (N5863_04230) | 880072..882870 | - | 2799 | WP_004124960.1 | transcriptional regulator DagR | - |
N5863_RS04235 (N5863_04235) | 883043..884026 | - | 984 | WP_004124956.1 | tRNA-modifying protein YgfZ | - |
N5863_RS04240 (N5863_04240) | 884271..884537 | + | 267 | WP_004124953.1 | FAD assembly factor SdhE | Antitoxin |
N5863_RS04245 (N5863_04245) | 884518..884928 | + | 411 | WP_004124948.1 | protein YgfX | Toxin |
N5863_RS04250 (N5863_04250) | 884937..885458 | - | 522 | WP_004124946.1 | flavodoxin FldB | - |
N5863_RS04255 (N5863_04255) | 885580..886476 | + | 897 | WP_284658846.1 | site-specific tyrosine recombinase XerD | - |
N5863_RS04260 (N5863_04260) | 886499..887212 | + | 714 | WP_004124939.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N5863_RS04265 (N5863_04265) | 887218..888951 | + | 1734 | WP_004124937.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16089.88 Da Isoelectric Point: 10.9455
>T259507 WP_004124948.1 NZ_CP104925:884518-884928 [Klebsiella pasteurii]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQE
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | H3N294 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3H3L9 |