Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 4732386..4732981 | Replicon | chromosome |
Accession | NZ_CP104920 | ||
Organism | Dickeya solani strain RNS 05.1.2A |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | RS71_RS21010 | Protein ID | WP_057084910.1 |
Coordinates | 4732386..4732763 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | RS71_RS21015 | Protein ID | WP_057084912.1 |
Coordinates | 4732760..4732981 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RS71_RS20990 | 4727691..4728722 | + | 1032 | WP_038922999.1 | methionine synthase | - |
RS71_RS20995 | 4728888..4729778 | - | 891 | WP_057084906.1 | oxidoreductase | - |
RS71_RS21000 | 4729909..4730532 | - | 624 | WP_057084908.1 | glutathione S-transferase | - |
RS71_RS21005 | 4730818..4732209 | + | 1392 | WP_057084955.1 | ATP-binding protein | - |
RS71_RS21010 | 4732386..4732763 | - | 378 | WP_057084910.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
RS71_RS21015 | 4732760..4732981 | - | 222 | WP_057084912.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
RS71_RS21020 | 4733122..4734270 | - | 1149 | WP_022633801.1 | L-threonine dehydrogenase | - |
RS71_RS21025 | 4734657..4735112 | + | 456 | WP_022633802.1 | NUDIX domain-containing protein | - |
RS71_RS21030 | 4735184..4735861 | - | 678 | WP_057084914.1 | respiratory nitrate reductase subunit gamma | - |
RS71_RS21035 | 4735861..4736580 | - | 720 | WP_022633804.1 | nitrate reductase molybdenum cofactor assembly chaperone | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14341.45 Da Isoelectric Point: 4.9149
>T259506 WP_057084910.1 NZ_CP104920:c4732763-4732386 [Dickeya solani]
MKWVSAQDVIDFHDRILQVLPDVVVMADPGRAEALVYRVQNRLYYEGVTELFELAATYWVTIARGHIFNDGNKHTAFFVT
MIFLRRNGILIVDNDNSLEELTIKAATGECLVSELAEQLRQRVEK
MKWVSAQDVIDFHDRILQVLPDVVVMADPGRAEALVYRVQNRLYYEGVTELFELAATYWVTIARGHIFNDGNKHTAFFVT
MIFLRRNGILIVDNDNSLEELTIKAATGECLVSELAEQLRQRVEK
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|