Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3242097..3242722 | Replicon | chromosome |
| Accession | NZ_CP104920 | ||
| Organism | Dickeya solani strain RNS 05.1.2A | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A2K8W3K4 |
| Locus tag | RS71_RS14655 | Protein ID | WP_022632574.1 |
| Coordinates | 3242097..3242300 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A2K8W3I1 |
| Locus tag | RS71_RS14660 | Protein ID | WP_022632575.1 |
| Coordinates | 3242354..3242722 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RS71_RS14625 | 3237719..3238057 | + | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
| RS71_RS14630 | 3238100..3239392 | + | 1293 | WP_022632570.1 | ammonium transporter AmtB | - |
| RS71_RS14635 | 3239487..3240350 | - | 864 | WP_057084532.1 | acyl-CoA thioesterase II | - |
| RS71_RS14640 | 3240622..3241179 | + | 558 | WP_057084531.1 | YbaY family lipoprotein | - |
| RS71_RS14645 | 3241208..3241537 | - | 330 | WP_057084530.1 | MGMT family protein | - |
| RS71_RS14655 | 3242097..3242300 | - | 204 | WP_022632574.1 | HHA domain-containing protein | Toxin |
| RS71_RS14660 | 3242354..3242722 | - | 369 | WP_022632575.1 | Hha toxicity modulator TomB | Antitoxin |
| RS71_RS14665 | 3243230..3243373 | - | 144 | WP_022632576.1 | type B 50S ribosomal protein L36 | - |
| RS71_RS14670 | 3243389..3243640 | - | 252 | WP_022632577.1 | type B 50S ribosomal protein L31 | - |
| RS71_RS14675 | 3243817..3246963 | - | 3147 | WP_022632578.1 | efflux RND transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8161.52 Da Isoelectric Point: 8.8580
>T259499 WP_022632574.1 NZ_CP104920:c3242300-3242097 [Dickeya solani]
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFYSAADHRLAELTMNKLYDKVPTAVWRYVR
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFYSAADHRLAELTMNKLYDKVPTAVWRYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14223.06 Da Isoelectric Point: 5.1663
>AT259499 WP_022632575.1 NZ_CP104920:c3242722-3242354 [Dickeya solani]
MDEYTPQHYDIAQLRFLCENLHDESIATLGDSSHGWVNDPTSAVNLQLNELIEHIAAFVVTYKIKYPHEAALCERVEKYL
DDTYILFSNYGINDTELRKWQKSKSQLFRMFSEKSICTVVKT
MDEYTPQHYDIAQLRFLCENLHDESIATLGDSSHGWVNDPTSAVNLQLNELIEHIAAFVVTYKIKYPHEAALCERVEKYL
DDTYILFSNYGINDTELRKWQKSKSQLFRMFSEKSICTVVKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2K8W3K4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2K8W3I1 |