Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3029051..3029835 | Replicon | chromosome |
Accession | NZ_CP104920 | ||
Organism | Dickeya solani strain RNS 05.1.2A |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | RS71_RS13675 | Protein ID | WP_057085420.1 |
Coordinates | 3029341..3029835 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | RS71_RS13670 | Protein ID | WP_057085421.1 |
Coordinates | 3029051..3029344 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RS71_RS13645 | 3024553..3025566 | + | 1014 | WP_057085431.1 | zinc-binding dehydrogenase | - |
RS71_RS13650 | 3025794..3026135 | + | 342 | WP_057085428.1 | helix-turn-helix domain-containing protein | - |
RS71_RS13655 | 3026352..3026931 | + | 580 | Protein_2650 | transposase | - |
RS71_RS13660 | 3027241..3027423 | + | 183 | WP_155518235.1 | hypothetical protein | - |
RS71_RS13665 | 3027570..3028712 | + | 1143 | WP_057085423.1 | Fic family protein | - |
RS71_RS13670 | 3029051..3029344 | + | 294 | WP_057085421.1 | DUF1778 domain-containing protein | Antitoxin |
RS71_RS13675 | 3029341..3029835 | + | 495 | WP_057085420.1 | GNAT family N-acetyltransferase | Toxin |
RS71_RS13680 | 3030119..3031861 | + | 1743 | WP_072143211.1 | TIGR04141 family sporadically distributed protein | - |
RS71_RS13685 | 3032141..3032446 | - | 306 | WP_057085415.1 | type II toxin-antitoxin system toxin CcdB | - |
RS71_RS13690 | 3032449..3032667 | - | 219 | WP_012773205.1 | type II toxin-antitoxin system antitoxin CcdA | - |
RS71_RS13695 | 3032726..3033469 | - | 744 | WP_057085413.1 | MobC family replication-relaxation protein | - |
RS71_RS13700 | 3033611..3033781 | + | 171 | WP_155518234.1 | hypothetical protein | - |
RS71_RS13705 | 3034380..3034721 | - | 342 | WP_057085460.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 17684.53 Da Isoelectric Point: 7.7788
>T259497 WP_057085420.1 NZ_CP104920:3029341-3029835 [Dickeya solani]
MISAPEPLRAEHVLSSFCCGVESMDNWLKQRAMKNQVTGASRTFVSCDDSKVLAYYSLASSAVATNAAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVADTIGIRGMLVHALSDEAREFYLRVGFEPSPIDPMLLMVTLGDLVG
SLSI
MISAPEPLRAEHVLSSFCCGVESMDNWLKQRAMKNQVTGASRTFVSCDDSKVLAYYSLASSAVATNAAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVADTIGIRGMLVHALSDEAREFYLRVGFEPSPIDPMLLMVTLGDLVG
SLSI
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|