Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 2510927..2511669 | Replicon | chromosome |
| Accession | NZ_CP104920 | ||
| Organism | Dickeya solani strain RNS 05.1.2A | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | E0SIC1 |
| Locus tag | RS71_RS11255 | Protein ID | WP_013316117.1 |
| Coordinates | 2511190..2511669 (+) | Length | 160 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A3N0G0N1 |
| Locus tag | RS71_RS11250 | Protein ID | WP_019843650.1 |
| Coordinates | 2510927..2511199 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RS71_RS11240 | 2506495..2508858 | - | 2364 | WP_057084318.1 | class I SAM-dependent DNA methyltransferase | - |
| RS71_RS11245 | 2509186..2510437 | - | 1252 | Protein_2178 | integrase arm-type DNA-binding domain-containing protein | - |
| RS71_RS11250 | 2510927..2511199 | + | 273 | WP_019843650.1 | DUF1778 domain-containing protein | Antitoxin |
| RS71_RS11255 | 2511190..2511669 | + | 480 | WP_013316117.1 | GNAT family N-acetyltransferase | Toxin |
| RS71_RS11260 | 2511698..2512099 | + | 402 | WP_057084319.1 | hypothetical protein | - |
| RS71_RS11265 | 2512244..2512540 | - | 297 | WP_057084320.1 | helix-turn-helix transcriptional regulator | - |
| RS71_RS11270 | 2512668..2512890 | + | 223 | Protein_2183 | helix-turn-helix domain-containing protein | - |
| RS71_RS11275 | 2512902..2513183 | - | 282 | WP_057084321.1 | Arm DNA-binding domain-containing protein | - |
| RS71_RS11285 | 2513791..2514861 | - | 1071 | WP_022631915.1 | LPS export ABC transporter permease LptG | - |
| RS71_RS11290 | 2514863..2515981 | - | 1119 | WP_022631914.1 | LPS export ABC transporter permease LptF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2488007..2512561 | 24554 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 160 a.a. Molecular weight: 17564.34 Da Isoelectric Point: 9.5367
>T259495 WP_013316117.1 NZ_CP104920:2511190-2511669 [Dickeya solani]
VGITAPELLLPQHAVVDFHCSEPSLNEWLKRKALKNQTLGASRTFVVCEAGTQRVVGFYALASGSIQRQVAPGAFRRNMP
DPIPVLVLGRLAVDERYQRMGIGAGLLKDAVLRSRNVAQQVGNKALLVHALSDEAKAFYQYWGFVPSEIQEHTLLLSLW
VGITAPELLLPQHAVVDFHCSEPSLNEWLKRKALKNQTLGASRTFVVCEAGTQRVVGFYALASGSIQRQVAPGAFRRNMP
DPIPVLVLGRLAVDERYQRMGIGAGLLKDAVLRSRNVAQQVGNKALLVHALSDEAKAFYQYWGFVPSEIQEHTLLLSLW
Download Length: 480 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3N0G158 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3N0G0N1 |