Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/- |
| Location | 1554531..1555117 | Replicon | chromosome |
| Accession | NZ_CP104917 | ||
| Organism | Avibacterium paragallinarum strain AP-2 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | N8E87_RS07695 | Protein ID | WP_264243865.1 |
| Coordinates | 1554531..1554779 (+) | Length | 83 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A3G8VZN0 |
| Locus tag | N8E87_RS07700 | Protein ID | WP_035687072.1 |
| Coordinates | 1554776..1555117 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8E87_RS07680 (N8E87_07680) | 1550553..1551752 | + | 1200 | WP_035688521.1 | tyrosine--tRNA ligase | - |
| N8E87_RS07685 (N8E87_07685) | 1552072..1553001 | + | 930 | WP_264243860.1 | aminoimidazole riboside kinase | - |
| N8E87_RS07690 (N8E87_07690) | 1553020..1554471 | + | 1452 | WP_264243862.1 | glycoside hydrolase family 32 protein | - |
| N8E87_RS07695 (N8E87_07695) | 1554531..1554779 | + | 249 | WP_264243865.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N8E87_RS07700 (N8E87_07700) | 1554776..1555117 | + | 342 | WP_035687072.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N8E87_RS07705 (N8E87_07705) | 1555212..1555688 | + | 477 | WP_264243867.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE | - |
| N8E87_RS07710 (N8E87_07710) | 1555701..1556948 | + | 1248 | WP_264243869.1 | N-acetylmuramoyl-L-alanine amidase | - |
| N8E87_RS07715 (N8E87_07715) | 1556957..1558930 | + | 1974 | WP_264243871.1 | DNA mismatch repair endonuclease MutL | - |
| N8E87_RS07720 (N8E87_07720) | 1558939..1559865 | + | 927 | WP_264243873.1 | tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 83 a.a. Molecular weight: 9239.88 Da Isoelectric Point: 10.2543
>T259491 WP_264243865.1 NZ_CP104917:1554531-1554779 [Avibacterium paragallinarum]
MGKSEKLLEKLANAKNTFIWTDLLTLLTRLGYEKREMTGSRVRFYNAELDHLILLHKPPPENYIKGGALKSVKEGLKGAG
LL
MGKSEKLLEKLANAKNTFIWTDLLTLLTRLGYEKREMTGSRVRFYNAELDHLILLHKPPPENYIKGGALKSVKEGLKGAG
LL
Download Length: 249 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 12710.50 Da Isoelectric Point: 4.5942
>AT259491 WP_035687072.1 NZ_CP104917:1554776-1555117 [Avibacterium paragallinarum]
MTLLKYKGYVGTIEADLENNVLFGKLAYIRDVITYEAETLPQLEKEFQTSVDLYLQDCQELGRTPDKPFKGVFNVRISEE
LHRNAVLAAGDLSLNAFVAEAIKEKVERAGITN
MTLLKYKGYVGTIEADLENNVLFGKLAYIRDVITYEAETLPQLEKEFQTSVDLYLQDCQELGRTPDKPFKGVFNVRISEE
LHRNAVLAAGDLSLNAFVAEAIKEKVERAGITN
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|