Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 1006722..1007290 Replicon chromosome
Accession NZ_CP104917
Organism Avibacterium paragallinarum strain AP-2

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag N8E87_RS04905 Protein ID WP_234702174.1
Coordinates 1006722..1007054 (-) Length 111 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A0A2Y0Z6
Locus tag N8E87_RS04910 Protein ID WP_039173908.1
Coordinates 1007054..1007290 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N8E87_RS04880 (N8E87_04880) 1001987..1002901 + 915 WP_110478712.1 baseplate J/gp47 family protein -
N8E87_RS04885 (N8E87_04885) 1002891..1003448 + 558 WP_264246385.1 phage tail protein I -
N8E87_RS04890 (N8E87_04890) 1003458..1005791 + 2334 WP_264246388.1 phage tail protein -
N8E87_RS04895 (N8E87_04895) 1005807..1006445 + 639 WP_264246391.1 DUF4376 domain-containing protein -
N8E87_RS04900 (N8E87_04900) 1006423..1006692 + 270 WP_039173903.1 hypothetical protein -
N8E87_RS04905 (N8E87_04905) 1006722..1007054 - 333 WP_234702174.1 endoribonuclease MazF Toxin
N8E87_RS04910 (N8E87_04910) 1007054..1007290 - 237 WP_039173908.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
N8E87_RS04915 (N8E87_04915) 1007467..1008675 + 1209 WP_264246399.1 phage tail sheath protein -
N8E87_RS04920 (N8E87_04920) 1008685..1009194 + 510 WP_110479649.1 phage major tail tube protein -
N8E87_RS04925 (N8E87_04925) 1009250..1009555 + 306 WP_264246400.1 phage tail assembly protein -
N8E87_RS04930 (N8E87_04930) 1009591..1009707 + 117 WP_207780522.1 GpE family phage tail protein -
N8E87_RS04935 (N8E87_04935) 1010009..1010449 + 441 WP_264246403.1 phage tail protein -
N8E87_RS04940 (N8E87_04940) 1010449..1011624 + 1176 WP_264246405.1 phage late control D family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 940449..1084743 144294


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(4-110)

Antitoxin

SpoVT-AbrB domain

(6-47)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 12352.48 Da        Isoelectric Point: 8.4983

>T259488 WP_234702174.1 NZ_CP104917:c1007054-1006722 [Avibacterium paragallinarum]
MKEYIPDVGDIIWLNFTPQAGHEQAGHRPAVVLSPKAYNHLTSLLICCPLTTKIKGYPFEVSIDGTPKNVVLSDQIKSLD
WRVRKAEFKGKIALDELAEIRQKIALLLNL

Download         Length: 333 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8645.89 Da        Isoelectric Point: 4.4151

>AT259488 WP_039173908.1 NZ_CP104917:c1007290-1007054 [Avibacterium paragallinarum]
MQLTIKKWGNSVGIRIPAPVLSELQLNVDHLVDMQVENGKIIIAPLPQQPSLTQLLANIHPDNLHQEVDFGEAEGGEW

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0A2Y0Z6

References