Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-RelB |
| Location | 851749..852336 | Replicon | chromosome |
| Accession | NZ_CP104917 | ||
| Organism | Avibacterium paragallinarum strain AP-2 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | N8E87_RS04140 | Protein ID | WP_264246201.1 |
| Coordinates | 852040..852336 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | N8E87_RS04135 | Protein ID | WP_264246763.1 |
| Coordinates | 851749..852039 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8E87_RS04115 (N8E87_04115) | 846956..848068 | + | 1113 | WP_264246193.1 | porin | - |
| N8E87_RS04120 (N8E87_04120) | 848341..849417 | + | 1077 | WP_264246195.1 | porin | - |
| N8E87_RS04125 (N8E87_04125) | 849639..850712 | + | 1074 | WP_264246197.1 | porin | - |
| N8E87_RS04130 (N8E87_04130) | 850833..851558 | - | 726 | WP_264246199.1 | carboxy-S-adenosyl-L-methionine synthase CmoA | - |
| N8E87_RS04135 (N8E87_04135) | 851749..852039 | + | 291 | WP_264246763.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| N8E87_RS04140 (N8E87_04140) | 852040..852336 | + | 297 | WP_264246201.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| N8E87_RS04145 (N8E87_04145) | 852424..854202 | + | 1779 | WP_264246203.1 | aspartate--tRNA ligase | - |
| N8E87_RS04150 (N8E87_04150) | 854335..854667 | + | 333 | WP_264246205.1 | glucose-6-phosphate dehydrogenase | - |
| N8E87_RS04155 (N8E87_04155) | 854815..855762 | + | 948 | WP_264246207.1 | transposase | - |
| N8E87_RS04160 (N8E87_04160) | 855741..856022 | + | 282 | WP_264246209.1 | hypothetical protein | - |
| N8E87_RS04165 (N8E87_04165) | 856149..856538 | + | 390 | WP_264246211.1 | hypothetical protein | - |
| N8E87_RS04170 (N8E87_04170) | 856501..856959 | + | 459 | WP_264246212.1 | dihydroneopterin triphosphate diphosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11453.58 Da Isoelectric Point: 8.7106
>T259487 WP_264246201.1 NZ_CP104917:852040-852336 [Avibacterium paragallinarum]
MNQSLPIKEIEMAKEFKRDLVQLAKKAPHLFVHPRYLEVMHCLTNGLALPAEYKNHPLKNNLKGYMDCHILNDLVLIYKI
EQQCLKLVRLNTHSEVFA
MNQSLPIKEIEMAKEFKRDLVQLAKKAPHLFVHPRYLEVMHCLTNGLALPAEYKNHPLKNNLKGYMDCHILNDLVLIYKI
EQQCLKLVRLNTHSEVFA
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|