Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-DnaT |
Location | 122598..123138 | Replicon | chromosome |
Accession | NZ_CP104917 | ||
Organism | Avibacterium paragallinarum strain AP-2 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | N8E87_RS00620 | Protein ID | WP_264245294.1 |
Coordinates | 122848..123138 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N8E87_RS00615 | Protein ID | WP_264245292.1 |
Coordinates | 122598..122858 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8E87_RS00605 (N8E87_00605) | 119062..120063 | + | 1002 | WP_264245287.1 | site-specific integrase | - |
N8E87_RS00610 (N8E87_00610) | 120965..122152 | + | 1188 | WP_264245289.1 | tyrosine-type recombinase/integrase | - |
N8E87_RS00615 (N8E87_00615) | 122598..122858 | + | 261 | WP_264245292.1 | stability protein StbD | Antitoxin |
N8E87_RS00620 (N8E87_00620) | 122848..123138 | + | 291 | WP_264245294.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N8E87_RS00625 (N8E87_00625) | 123866..124156 | + | 291 | WP_017806817.1 | co-chaperone GroES | - |
N8E87_RS00630 (N8E87_00630) | 124235..125878 | + | 1644 | WP_264245296.1 | chaperonin GroEL | - |
N8E87_RS00635 (N8E87_00635) | 126161..127108 | - | 948 | WP_264245298.1 | cysteine synthase A | - |
N8E87_RS00640 (N8E87_00640) | 127264..128076 | - | 813 | WP_264245300.1 | sulfate transporter CysZ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | htpB | 107468..136392 | 28924 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11444.39 Da Isoelectric Point: 10.6525
>T259485 WP_264245294.1 NZ_CP104917:122848-123138 [Avibacterium paragallinarum]
MTYKLSFDKRALKEWYKLGDTLRQQFKAKLIERLENPHVLSDKLHGYQTLYKIKLRSAGYRLVYDVNDNEIRVIVLSVGK
RERLQAYKKALSRKAQ
MTYKLSFDKRALKEWYKLGDTLRQQFKAKLIERLENPHVLSDKLHGYQTLYKIKLRSAGYRLVYDVNDNEIRVIVLSVGK
RERLQAYKKALSRKAQ
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|