Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-DnaT |
Location | 113510..114050 | Replicon | chromosome |
Accession | NZ_CP104917 | ||
Organism | Avibacterium paragallinarum strain AP-2 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | N8E87_RS00565 | Protein ID | WP_110479397.1 |
Coordinates | 113760..114050 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N8E87_RS00560 | Protein ID | WP_110479398.1 |
Coordinates | 113510..113770 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8E87_RS00540 (N8E87_00540) | 109635..110846 | + | 1212 | WP_264245268.1 | tyrosine-type recombinase/integrase | - |
N8E87_RS00545 (N8E87_00545) | 111507..111713 | + | 207 | WP_264245270.1 | AlpA family phage regulatory protein | - |
N8E87_RS00550 (N8E87_00550) | 111717..112394 | + | 678 | WP_264245271.1 | hypothetical protein | - |
N8E87_RS00555 (N8E87_00555) | 112406..113371 | + | 966 | WP_264245273.1 | phage major capsid protein, P2 family | - |
N8E87_RS00560 (N8E87_00560) | 113510..113770 | + | 261 | WP_110479398.1 | stability protein StbD | Antitoxin |
N8E87_RS00565 (N8E87_00565) | 113760..114050 | + | 291 | WP_110479397.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N8E87_RS00570 (N8E87_00570) | 114092..115192 | + | 1101 | WP_264245275.1 | hypothetical protein | - |
N8E87_RS00575 (N8E87_00575) | 115356..115571 | + | 216 | WP_035688136.1 | helix-turn-helix domain-containing protein | - |
N8E87_RS00580 (N8E87_00580) | 115582..115887 | + | 306 | WP_264245277.1 | Lar family restriction alleviation protein | - |
N8E87_RS00585 (N8E87_00585) | 115991..116557 | + | 567 | WP_264245279.1 | ash family protein | - |
N8E87_RS00590 (N8E87_00590) | 116550..116819 | + | 270 | WP_264245281.1 | hypothetical protein | - |
N8E87_RS00595 (N8E87_00595) | 116809..117048 | + | 240 | WP_264245283.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | htpB | 107468..136392 | 28924 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11418.36 Da Isoelectric Point: 10.7313
>T259484 WP_110479397.1 NZ_CP104917:113760-114050 [Avibacterium paragallinarum]
MTYKLSFDKRALKEWHKLGDTLRQQFKAKLIERLENPHVLSDKLHGYQTLYKIKLRSAGYRLVYDVNDNEIRVIVLSVGK
RERLQAYKKALSRKAQ
MTYKLSFDKRALKEWHKLGDTLRQQFKAKLIERLENPHVLSDKLHGYQTLYKIKLRSAGYRLVYDVNDNEIRVIVLSVGK
RERLQAYKKALSRKAQ
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|