Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB-HicA |
| Location | 2186761..2187415 | Replicon | chromosome |
| Accession | NZ_CP104914 | ||
| Organism | Avibacterium paragallinarum strain AG21-0333 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A0F5EPP6 |
| Locus tag | N8E86_RS10350 | Protein ID | WP_046099083.1 |
| Coordinates | 2186761..2186943 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A0F5ERJ0 |
| Locus tag | N8E86_RS10355 | Protein ID | WP_046099082.1 |
| Coordinates | 2186996..2187415 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8E86_RS10320 (N8E86_10320) | 2182364..2183800 | - | 1437 | WP_264255878.1 | baseplate J/gp47 family protein | - |
| N8E86_RS10325 (N8E86_10325) | 2183793..2184158 | - | 366 | WP_264255880.1 | hypothetical protein | - |
| N8E86_RS10330 (N8E86_10330) | 2184155..2184826 | - | 672 | WP_264255882.1 | Gp138 family membrane-puncturing spike protein | - |
| N8E86_RS10335 (N8E86_10335) | 2184819..2185784 | - | 966 | WP_264255883.1 | hypothetical protein | - |
| N8E86_RS10340 (N8E86_10340) | 2185762..2186094 | - | 333 | WP_194743101.1 | hypothetical protein | - |
| N8E86_RS10345 (N8E86_10345) | 2186094..2186672 | - | 579 | WP_264255884.1 | hypothetical protein | - |
| N8E86_RS10350 (N8E86_10350) | 2186761..2186943 | + | 183 | WP_046099083.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N8E86_RS10355 (N8E86_10355) | 2186996..2187415 | + | 420 | WP_046099082.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N8E86_RS10360 (N8E86_10360) | 2187453..2188766 | - | 1314 | WP_264255885.1 | hypothetical protein | - |
| N8E86_RS10365 (N8E86_10365) | 2188880..2190088 | + | 1209 | WP_006250222.1 | IS4-like element ISVsa5 family transposase | - |
| N8E86_RS10370 (N8E86_10370) | 2190098..2190514 | - | 417 | WP_000275180.1 | AraC family transcriptional regulator | - |
| N8E86_RS10375 (N8E86_10375) | 2190602..2191184 | + | 583 | Protein_1997 | tetracyline resistance-associated transcriptional repressor TetC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | tet(B) | - | 2131539..2243247 | 111708 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6957.05 Da Isoelectric Point: 10.3460
>T259483 WP_046099083.1 NZ_CP104914:2186761-2186943 [Avibacterium paragallinarum]
MKYSEFLRYLLEQGCKVENTKRGSHRKVTLNGHQTVFPYHGSQEIGTGLVHKIKKDLNLK
MKYSEFLRYLLEQGCKVENTKRGSHRKVTLNGHQTVFPYHGSQEIGTGLVHKIKKDLNLK
Download Length: 183 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15815.31 Da Isoelectric Point: 4.7276
>AT259483 WP_046099082.1 NZ_CP104914:2186996-2187415 [Avibacterium paragallinarum]
MLRYPVELKADDNGTFLVTFPDIPEAASVGEDLESALLEAEEGLETALEFYFDDKRPIPLPSKPQEGQYTVPLSLLRSLK
VLLLNEMLAQGVRKAEMARRLDVHMPQIDRLLDFRYPSKIDFVEKAFKKLGREIHLAVS
MLRYPVELKADDNGTFLVTFPDIPEAASVGEDLESALLEAEEGLETALEFYFDDKRPIPLPSKPQEGQYTVPLSLLRSLK
VLLLNEMLAQGVRKAEMARRLDVHMPQIDRLLDFRYPSKIDFVEKAFKKLGREIHLAVS
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0F5EPP6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0F5ERJ0 |