Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB-HicA
Location 2186761..2187415 Replicon chromosome
Accession NZ_CP104914
Organism Avibacterium paragallinarum strain AG21-0333

Toxin (Protein)


Gene name hicA Uniprot ID A0A0F5EPP6
Locus tag N8E86_RS10350 Protein ID WP_046099083.1
Coordinates 2186761..2186943 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A0F5ERJ0
Locus tag N8E86_RS10355 Protein ID WP_046099082.1
Coordinates 2186996..2187415 (+) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N8E86_RS10320 (N8E86_10320) 2182364..2183800 - 1437 WP_264255878.1 baseplate J/gp47 family protein -
N8E86_RS10325 (N8E86_10325) 2183793..2184158 - 366 WP_264255880.1 hypothetical protein -
N8E86_RS10330 (N8E86_10330) 2184155..2184826 - 672 WP_264255882.1 Gp138 family membrane-puncturing spike protein -
N8E86_RS10335 (N8E86_10335) 2184819..2185784 - 966 WP_264255883.1 hypothetical protein -
N8E86_RS10340 (N8E86_10340) 2185762..2186094 - 333 WP_194743101.1 hypothetical protein -
N8E86_RS10345 (N8E86_10345) 2186094..2186672 - 579 WP_264255884.1 hypothetical protein -
N8E86_RS10350 (N8E86_10350) 2186761..2186943 + 183 WP_046099083.1 type II toxin-antitoxin system HicA family toxin Toxin
N8E86_RS10355 (N8E86_10355) 2186996..2187415 + 420 WP_046099082.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
N8E86_RS10360 (N8E86_10360) 2187453..2188766 - 1314 WP_264255885.1 hypothetical protein -
N8E86_RS10365 (N8E86_10365) 2188880..2190088 + 1209 WP_006250222.1 IS4-like element ISVsa5 family transposase -
N8E86_RS10370 (N8E86_10370) 2190098..2190514 - 417 WP_000275180.1 AraC family transcriptional regulator -
N8E86_RS10375 (N8E86_10375) 2190602..2191184 + 583 Protein_1997 tetracyline resistance-associated transcriptional repressor TetC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element tet(B) - 2131539..2243247 111708


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-58)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-63)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6957.05 Da        Isoelectric Point: 10.3460

>T259483 WP_046099083.1 NZ_CP104914:2186761-2186943 [Avibacterium paragallinarum]
MKYSEFLRYLLEQGCKVENTKRGSHRKVTLNGHQTVFPYHGSQEIGTGLVHKIKKDLNLK

Download         Length: 183 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15815.31 Da        Isoelectric Point: 4.7276

>AT259483 WP_046099082.1 NZ_CP104914:2186996-2187415 [Avibacterium paragallinarum]
MLRYPVELKADDNGTFLVTFPDIPEAASVGEDLESALLEAEEGLETALEFYFDDKRPIPLPSKPQEGQYTVPLSLLRSLK
VLLLNEMLAQGVRKAEMARRLDVHMPQIDRLLDFRYPSKIDFVEKAFKKLGREIHLAVS

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0F5EPP6

Antitoxin

Source ID Structure
AlphaFold DB A0A0F5ERJ0

References