Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2139467..2140069 | Replicon | chromosome |
| Accession | NZ_CP104914 | ||
| Organism | Avibacterium paragallinarum strain AG21-0333 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | N8E86_RS10110 | Protein ID | WP_017807336.1 |
| Coordinates | 2139893..2140069 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | N8E86_RS10105 | Protein ID | WP_194743128.1 |
| Coordinates | 2139467..2139871 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8E86_RS10070 (N8E86_10070) | 2134536..2134868 | + | 333 | WP_264255822.1 | hypothetical protein | - |
| N8E86_RS10075 (N8E86_10075) | 2134836..2135489 | - | 654 | WP_264255824.1 | IS1595 family transposase | - |
| N8E86_RS10080 (N8E86_10080) | 2135566..2136021 | + | 456 | WP_264255825.1 | hypothetical protein | - |
| N8E86_RS10085 (N8E86_10085) | 2136018..2137454 | + | 1437 | WP_264255827.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| N8E86_RS10090 (N8E86_10090) | 2137457..2138050 | + | 594 | WP_264257063.1 | phage N-6-adenine-methyltransferase | - |
| N8E86_RS10095 (N8E86_10095) | 2138040..2138465 | + | 426 | WP_264255828.1 | recombination protein NinB | - |
| N8E86_RS10100 (N8E86_10100) | 2138503..2139186 | - | 684 | WP_264255830.1 | P22AR C-terminal domain-containing protein | - |
| N8E86_RS10105 (N8E86_10105) | 2139467..2139871 | - | 405 | WP_194743128.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N8E86_RS10110 (N8E86_10110) | 2139893..2140069 | - | 177 | WP_017807336.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N8E86_RS10115 (N8E86_10115) | 2140178..2140744 | + | 567 | WP_264255834.1 | recombination protein NinG | - |
| N8E86_RS10120 (N8E86_10120) | 2140838..2142586 | + | 1749 | WP_264255835.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | tet(B) | - | 2131539..2243247 | 111708 | |
| - | flank | IS/Tn | - | - | 2134836..2135489 | 653 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6714.77 Da Isoelectric Point: 10.6249
>T259482 WP_017807336.1 NZ_CP104914:c2140069-2139893 [Avibacterium paragallinarum]
VNSKQMIKLLKQDGWYLDSINGSHHHFEHHQKKGKVTVPHPRAELGHLEKLIRKQAGL
VNSKQMIKLLKQDGWYLDSINGSHHHFEHHQKKGKVTVPHPRAELGHLEKLIRKQAGL
Download Length: 177 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14939.02 Da Isoelectric Point: 4.7447
>AT259482 WP_194743128.1 NZ_CP104914:c2139871-2139467 [Avibacterium paragallinarum]
MLYPIALEKVTDGYVVSVPDIPGCFSAGDTLEEAYNNVKQAITSHLELVVRDNEEVPLPTPLEEHKANPDYQSVDIFFGV
IDVDISHLLGKAERINITMPAYLIKRIDDFVATHPHYKSRSHFLASVSADKIMA
MLYPIALEKVTDGYVVSVPDIPGCFSAGDTLEEAYNNVKQAITSHLELVVRDNEEVPLPTPLEEHKANPDYQSVDIFFGV
IDVDISHLLGKAERINITMPAYLIKRIDDFVATHPHYKSRSHFLASVSADKIMA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|