Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 1911166..1911682 | Replicon | chromosome |
| Accession | NZ_CP104914 | ||
| Organism | Avibacterium paragallinarum strain AG21-0333 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | N8E86_RS08920 | Protein ID | WP_264255656.1 |
| Coordinates | 1911398..1911682 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | N8E86_RS08915 | Protein ID | WP_264255655.1 |
| Coordinates | 1911166..1911408 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8E86_RS08895 (N8E86_08895) | 1906407..1907249 | + | 843 | WP_039085670.1 | ABC transporter permease | - |
| N8E86_RS08900 (N8E86_08900) | 1907273..1908358 | + | 1086 | WP_264257055.1 | extracellular solute-binding protein | - |
| N8E86_RS08905 (N8E86_08905) | 1908543..1909853 | + | 1311 | WP_264255653.1 | histidine-type phosphatase | - |
| N8E86_RS08910 (N8E86_08910) | 1909953..1911050 | + | 1098 | WP_264255654.1 | ROK family protein | - |
| N8E86_RS08915 (N8E86_08915) | 1911166..1911408 | + | 243 | WP_264255655.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| N8E86_RS08920 (N8E86_08920) | 1911398..1911682 | + | 285 | WP_264255656.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N8E86_RS08925 (N8E86_08925) | 1911732..1912298 | - | 567 | WP_103853318.1 | elongation factor P | - |
| N8E86_RS08930 (N8E86_08930) | 1912333..1913346 | + | 1014 | WP_264255657.1 | EF-P beta-lysylation protein EpmB | - |
| N8E86_RS08935 (N8E86_08935) | 1913418..1914494 | + | 1077 | WP_264255658.1 | LysM-like peptidoglycan-binding domain-containing protein | - |
| N8E86_RS08940 (N8E86_08940) | 1914958..1915083 | - | 126 | WP_261764806.1 | hypothetical protein | - |
| N8E86_RS08945 (N8E86_08945) | 1915154..1916059 | - | 906 | WP_026138508.1 | recombination-associated protein RdgC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11197.07 Da Isoelectric Point: 10.4599
>T259481 WP_264255656.1 NZ_CP104914:1911398-1911682 [Avibacterium paragallinarum]
MSYELVFDPRALKEWRKLGENIKAQFKKKLAEILRNPRIEANRLSHFPDCYKIKLRNAGYRLIYQVQDEQVVVFVVAIGK
RENNQAYKEAKTRL
MSYELVFDPRALKEWRKLGENIKAQFKKKLAEILRNPRIEANRLSHFPDCYKIKLRNAGYRLIYQVQDEQVVVFVVAIGK
RENNQAYKEAKTRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|