Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 255404..256057 | Replicon | chromosome |
| Accession | NZ_CP104912 | ||
| Organism | Acinetobacter baumannii strain YZM-0406 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | N7285_RS01360 | Protein ID | WP_000607077.1 |
| Coordinates | 255668..256057 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | N7285_RS01355 | Protein ID | WP_001288210.1 |
| Coordinates | 255404..255661 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7285_RS01335 (N7285_01335) | 250920..251927 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
| N7285_RS01340 (N7285_01340) | 251946..252323 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| N7285_RS01345 (N7285_01345) | 252505..253995 | + | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| N7285_RS01350 (N7285_01350) | 254044..255216 | - | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
| N7285_RS01355 (N7285_01355) | 255404..255661 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| N7285_RS01360 (N7285_01360) | 255668..256057 | + | 390 | WP_000607077.1 | membrane protein | Toxin |
| N7285_RS01365 (N7285_01365) | 256827..257912 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
| N7285_RS01370 (N7285_01370) | 257990..258556 | + | 567 | WP_000651538.1 | rhombosortase | - |
| N7285_RS01375 (N7285_01375) | 258744..260939 | + | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T259470 WP_000607077.1 NZ_CP104912:255668-256057 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|