Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
Location | 5330..5918 | Replicon | plasmid punamed1 |
Accession | NZ_CP104911 | ||
Organism | Acinetobacter baumannii strain YZM-0406 |
Toxin (Protein)
Gene name | brnT | Uniprot ID | A0A3G6Z3M6 |
Locus tag | N7285_RS00030 | Protein ID | WP_000438826.1 |
Coordinates | 5631..5918 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | N9M5I3 |
Locus tag | N7285_RS00025 | Protein ID | WP_001983304.1 |
Coordinates | 5330..5644 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7285_RS00005 (N7285_00005) | 1158..1529 | + | 372 | WP_000504218.1 | hypothetical protein | - |
N7285_RS00010 (N7285_00010) | 1529..1702 | + | 174 | WP_001282484.1 | hypothetical protein | - |
N7285_RS00015 (N7285_00015) | 2025..2486 | - | 462 | WP_000761346.1 | DIP1984 family protein | - |
N7285_RS00020 (N7285_00020) | 2791..5202 | - | 2412 | WP_000932953.1 | TonB-dependent receptor ZnuD2 | - |
N7285_RS00025 (N7285_00025) | 5330..5644 | - | 315 | WP_001983304.1 | BrnA antitoxin family protein | Antitoxin |
N7285_RS00030 (N7285_00030) | 5631..5918 | - | 288 | WP_000438826.1 | BrnT family toxin | Toxin |
N7285_RS00035 (N7285_00035) | 6291..6809 | + | 519 | WP_000447193.1 | tetratricopeptide repeat protein | - |
N7285_RS00040 (N7285_00040) | 6998..7141 | - | 144 | WP_001125246.1 | hypothetical protein | - |
N7285_RS00045 (N7285_00045) | 7161..7736 | - | 576 | WP_001096616.1 | plasmid replication DNA-binding protein | - |
N7285_RS00050 (N7285_00050) | 7729..8679 | - | 951 | WP_001205343.1 | replication initiation protein RepM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..8731 | 8731 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11303.72 Da Isoelectric Point: 6.0889
>T259469 WP_000438826.1 NZ_CP104911:c5918-5631 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G6Z3M6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | N9M5I3 |