Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafN(antitoxin)
Location 3077703..3078268 Replicon chromosome
Accession NZ_CP104900
Organism Shewanella seohaensis strain KCTC 23556

Toxin (Protein)


Gene name relE Uniprot ID A0A7X8U0A9
Locus tag N7V09_RS13840 Protein ID WP_029865673.1
Coordinates 3077703..3077990 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U3BLE1
Locus tag N7V09_RS13845 Protein ID WP_000086647.1
Coordinates 3077987..3078268 (-) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7V09_RS13810 (N7V09_13810) 3073140..3073376 + 237 WP_086903492.1 DUF2897 family protein -
N7V09_RS13815 (N7V09_13815) 3073750..3074172 - 423 WP_248968902.1 GNAT family N-acetyltransferase -
N7V09_RS13820 (N7V09_13820) 3074306..3075507 - 1202 Protein_2682 IS4 family transposase -
N7V09_RS13825 (N7V09_13825) 3075619..3076155 - 537 WP_262251001.1 DUF2185 domain-containing protein -
N7V09_RS13830 (N7V09_13830) 3076336..3076665 - 330 WP_248968899.1 hypothetical protein -
N7V09_RS13835 (N7V09_13835) 3076818..3077531 - 714 WP_248968898.1 hypothetical protein -
N7V09_RS13840 (N7V09_13840) 3077703..3077990 - 288 WP_029865673.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N7V09_RS13845 (N7V09_13845) 3077987..3078268 - 282 WP_000086647.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N7V09_RS13850 (N7V09_13850) 3078419..3079435 - 1017 WP_262251002.1 hypothetical protein -
N7V09_RS13855 (N7V09_13855) 3079402..3079878 - 477 WP_248968896.1 hypothetical protein -
N7V09_RS13860 (N7V09_13860) 3080291..3081313 + 1023 WP_262251003.1 IS110 family transposase -
N7V09_RS13865 (N7V09_13865) 3081999..3082585 - 587 Protein_2691 cytochrome c3 family protein -
N7V09_RS13870 (N7V09_13870) 3082594..3083079 - 486 WP_248969097.1 nitrate reductase cytochrome c-type subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 3074306..3081313 7007
- inside Integron - - 3075619..3079435 3816


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(9-74)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10993.65 Da        Isoelectric Point: 5.1098

>T259463 WP_029865673.1 NZ_CP104900:c3077990-3077703 [Shewanella seohaensis]
MKVVWSPLALQKLGDAAEFISLDNPSAAEKWVNEVFDKTELLGSMPEMGRFVPEMPHTNYREIIFGHYRIIYSLSHEIRV
LTVRNCRQILSEDDV

Download         Length: 288 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10398.91 Da        Isoelectric Point: 5.8650

>AT259463 WP_000086647.1 NZ_CP104900:c3078268-3077987 [Shewanella seohaensis]
MSRIHFDQDIQPLSEFRAGVASYIKQINETRRPLVITQRGKGVAVVLDVAEYEAMQEKIELLEEMRTAEAQLASGLGVSN
DDARAQVLGRIKK

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7X8U0A9

Antitoxin

Source ID Structure
AlphaFold DB A0A4P8G0X0

References