Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB-HicA
Location 2093010..2093663 Replicon chromosome
Accession NZ_CP104882
Organism Aggregatibacter actinomycetemcomitans strain IDHaas10a

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag N7761_RS10265 Protein ID WP_005578509.1
Coordinates 2093010..2093192 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag N7761_RS10270 Protein ID WP_014167744.1
Coordinates 2093244..2093663 (+) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7761_RS10250 (N7761_10250) 2089746..2090579 + 834 WP_005590095.1 integrase arm-type DNA-binding domain-containing protein -
N7761_RS10255 (N7761_10255) 2090732..2091343 - 612 WP_005590093.1 DUF4376 domain-containing protein -
N7761_RS10260 (N7761_10260) 2091343..2092509 - 1167 WP_005590091.1 phage tail protein -
N7761_RS10265 (N7761_10265) 2093010..2093192 + 183 WP_005578509.1 type II toxin-antitoxin system HicA family toxin Toxin
N7761_RS10270 (N7761_10270) 2093244..2093663 + 420 WP_014167744.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
N7761_RS10275 (N7761_10275) 2093837..2094052 - 216 WP_262088982.1 hypothetical protein -
N7761_RS10280 (N7761_10280) 2094049..2094528 - 480 WP_005572281.1 hypothetical protein -
N7761_RS10285 (N7761_10285) 2094544..2094723 - 180 WP_005572280.1 hypothetical protein -
N7761_RS10290 (N7761_10290) 2094816..2095124 - 309 WP_005572279.1 hypothetical protein -
N7761_RS10295 (N7761_10295) 2095275..2095643 - 369 WP_005592078.1 helix-turn-helix domain-containing protein -
N7761_RS10300 (N7761_10300) 2095686..2096129 - 444 WP_005572275.1 YmfL family putative regulatory protein -
N7761_RS10305 (N7761_10305) 2096735..2097091 + 357 WP_005572272.1 DUF2513 domain-containing protein -
N7761_RS10310 (N7761_10310) 2097156..2097380 + 225 WP_005545968.1 hypothetical protein -
N7761_RS10315 (N7761_10315) 2097824..2098481 + 658 Protein_1989 BRO family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2089761..2100596 10835


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-58)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-63)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6952.13 Da        Isoelectric Point: 10.1091

>T259460 WP_005578509.1 NZ_CP104882:2093010-2093192 [Aggregatibacter actinomycetemcomitans]
MKYSEFLRYLLEQGCKVEATKRGSHRKVTLNECQTVFPYHGSKEIGTGLVHKIKKDLNLK

Download         Length: 183 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15901.43 Da        Isoelectric Point: 4.7175

>AT259460 WP_014167744.1 NZ_CP104882:2093244-2093663 [Aggregatibacter actinomycetemcomitans]
MLRYPVEITPDDNGTFLVTCPDIPEMASVGEDIESALLEAEEGLETALEFYFDDKRPIPMPSQPKDGQYMVPLSLLRSLK
VFLLNEMLAQGVRKAEMARRLDVHMPQVDRLLDFRHPSKIDFVEKAFKKLGREINLSVH

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References