Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB-HicA |
| Location | 2093010..2093663 | Replicon | chromosome |
| Accession | NZ_CP104882 | ||
| Organism | Aggregatibacter actinomycetemcomitans strain IDHaas10a | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | N7761_RS10265 | Protein ID | WP_005578509.1 |
| Coordinates | 2093010..2093192 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | N7761_RS10270 | Protein ID | WP_014167744.1 |
| Coordinates | 2093244..2093663 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7761_RS10250 (N7761_10250) | 2089746..2090579 | + | 834 | WP_005590095.1 | integrase arm-type DNA-binding domain-containing protein | - |
| N7761_RS10255 (N7761_10255) | 2090732..2091343 | - | 612 | WP_005590093.1 | DUF4376 domain-containing protein | - |
| N7761_RS10260 (N7761_10260) | 2091343..2092509 | - | 1167 | WP_005590091.1 | phage tail protein | - |
| N7761_RS10265 (N7761_10265) | 2093010..2093192 | + | 183 | WP_005578509.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N7761_RS10270 (N7761_10270) | 2093244..2093663 | + | 420 | WP_014167744.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N7761_RS10275 (N7761_10275) | 2093837..2094052 | - | 216 | WP_262088982.1 | hypothetical protein | - |
| N7761_RS10280 (N7761_10280) | 2094049..2094528 | - | 480 | WP_005572281.1 | hypothetical protein | - |
| N7761_RS10285 (N7761_10285) | 2094544..2094723 | - | 180 | WP_005572280.1 | hypothetical protein | - |
| N7761_RS10290 (N7761_10290) | 2094816..2095124 | - | 309 | WP_005572279.1 | hypothetical protein | - |
| N7761_RS10295 (N7761_10295) | 2095275..2095643 | - | 369 | WP_005592078.1 | helix-turn-helix domain-containing protein | - |
| N7761_RS10300 (N7761_10300) | 2095686..2096129 | - | 444 | WP_005572275.1 | YmfL family putative regulatory protein | - |
| N7761_RS10305 (N7761_10305) | 2096735..2097091 | + | 357 | WP_005572272.1 | DUF2513 domain-containing protein | - |
| N7761_RS10310 (N7761_10310) | 2097156..2097380 | + | 225 | WP_005545968.1 | hypothetical protein | - |
| N7761_RS10315 (N7761_10315) | 2097824..2098481 | + | 658 | Protein_1989 | BRO family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2089761..2100596 | 10835 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6952.13 Da Isoelectric Point: 10.1091
>T259460 WP_005578509.1 NZ_CP104882:2093010-2093192 [Aggregatibacter actinomycetemcomitans]
MKYSEFLRYLLEQGCKVEATKRGSHRKVTLNECQTVFPYHGSKEIGTGLVHKIKKDLNLK
MKYSEFLRYLLEQGCKVEATKRGSHRKVTLNECQTVFPYHGSKEIGTGLVHKIKKDLNLK
Download Length: 183 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15901.43 Da Isoelectric Point: 4.7175
>AT259460 WP_014167744.1 NZ_CP104882:2093244-2093663 [Aggregatibacter actinomycetemcomitans]
MLRYPVEITPDDNGTFLVTCPDIPEMASVGEDIESALLEAEEGLETALEFYFDDKRPIPMPSQPKDGQYMVPLSLLRSLK
VFLLNEMLAQGVRKAEMARRLDVHMPQVDRLLDFRHPSKIDFVEKAFKKLGREINLSVH
MLRYPVEITPDDNGTFLVTCPDIPEMASVGEDIESALLEAEEGLETALEFYFDDKRPIPMPSQPKDGQYMVPLSLLRSLK
VFLLNEMLAQGVRKAEMARRLDVHMPQVDRLLDFRHPSKIDFVEKAFKKLGREINLSVH
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|