Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-RelB |
| Location | 2087414..2087964 | Replicon | chromosome |
| Accession | NZ_CP104882 | ||
| Organism | Aggregatibacter actinomycetemcomitans strain IDHaas10a | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | N7761_RS10240 | Protein ID | WP_014167746.1 |
| Coordinates | 2087698..2087964 (+) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | X2JQ67 |
| Locus tag | N7761_RS10235 | Protein ID | WP_005539223.1 |
| Coordinates | 2087414..2087686 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7761_RS10215 (N7761_10215) | 2083393..2084889 | - | 1497 | WP_262088981.1 | transcription termination factor NusA | - |
| N7761_RS10220 (N7761_10220) | 2084913..2085368 | - | 456 | WP_005569409.1 | ribosome maturation factor RimP | - |
| N7761_RS10230 (N7761_10230) | 2085807..2087159 | + | 1353 | WP_005545994.1 | anaerobic C4-dicarboxylate transporter DcuC | - |
| N7761_RS10235 (N7761_10235) | 2087414..2087686 | + | 273 | WP_005539223.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| N7761_RS10240 (N7761_10240) | 2087698..2087964 | + | 267 | WP_014167746.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
| N7761_RS10245 (N7761_10245) | 2087996..2089555 | + | 1560 | WP_005590096.1 | glutamine-hydrolyzing GMP synthase | - |
| N7761_RS10250 (N7761_10250) | 2089746..2090579 | + | 834 | WP_005590095.1 | integrase arm-type DNA-binding domain-containing protein | - |
| N7761_RS10255 (N7761_10255) | 2090732..2091343 | - | 612 | WP_005590093.1 | DUF4376 domain-containing protein | - |
| N7761_RS10260 (N7761_10260) | 2091343..2092509 | - | 1167 | WP_005590091.1 | phage tail protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10516.05 Da Isoelectric Point: 7.2393
>T259459 WP_014167746.1 NZ_CP104882:2087698-2087964 [Aggregatibacter actinomycetemcomitans]
MDYVLSKEYKRDLKKIPVEIQSGPEYAEVLYCLFNQKSLPERYKDHALQGNWQGFRDCHIKNDLILIYKIEADTLYFARL
NSHSEVFK
MDYVLSKEYKRDLKKIPVEIQSGPEYAEVLYCLFNQKSLPERYKDHALQGNWQGFRDCHIKNDLILIYKIEADTLYFARL
NSHSEVFK
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|