Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YoeB-YefM |
| Location | 1521302..1521804 | Replicon | chromosome |
| Accession | NZ_CP104882 | ||
| Organism | Aggregatibacter actinomycetemcomitans strain IDHaas10a | ||
Toxin (Protein)
| Gene name | relB | Uniprot ID | S4W640 |
| Locus tag | N7761_RS07610 | Protein ID | WP_005556313.1 |
| Coordinates | 1521302..1521556 (-) | Length | 85 a.a. |
Antitoxin (Protein)
| Gene name | relE | Uniprot ID | X2JX79 |
| Locus tag | N7761_RS07615 | Protein ID | WP_005547296.1 |
| Coordinates | 1521553..1521804 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7761_RS07595 (N7761_07595) | 1517235..1519409 | + | 2175 | WP_005556309.1 | DNA helicase II | - |
| N7761_RS07600 (N7761_07600) | 1519542..1520369 | - | 828 | WP_005556311.1 | DNA ligase | - |
| N7761_RS07605 (N7761_07605) | 1520546..1521289 | - | 744 | WP_005542222.1 | YdcF family protein | - |
| N7761_RS07610 (N7761_07610) | 1521302..1521556 | - | 255 | WP_005556313.1 | Txe/YoeB family addiction module toxin | Toxin |
| N7761_RS07615 (N7761_07615) | 1521553..1521804 | - | 252 | WP_005547296.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| N7761_RS07620 (N7761_07620) | 1521913..1522869 | - | 957 | WP_005556319.1 | polysaccharide pyruvyl transferase family protein | - |
| N7761_RS07625 (N7761_07625) | 1522866..1524389 | - | 1524 | WP_053330415.1 | polysaccharide biosynthesis protein | - |
| N7761_RS07630 (N7761_07630) | 1524523..1525296 | + | 774 | WP_025298488.1 | glycosyltransferase family 25 protein | - |
| N7761_RS07635 (N7761_07635) | 1525305..1526498 | + | 1194 | WP_005556328.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10217.71 Da Isoelectric Point: 8.8844
>T259456 WP_005556313.1 NZ_CP104882:c1521556-1521302 [Aggregatibacter actinomycetemcomitans]
MILAWTETAWEDYLYWQQVDKKTLLRINKLIQNITRSPFEGLGNPEPLKHQLSGFWSRRIDKEHRLVYQVSDSHLTIIQC
RYHY
MILAWTETAWEDYLYWQQVDKKTLLRINKLIQNITRSPFEGLGNPEPLKHQLSGFWSRRIDKEHRLVYQVSDSHLTIIQC
RYHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|