Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-DnaT |
Location | 1438360..1438894 | Replicon | chromosome |
Accession | NZ_CP104882 | ||
Organism | Aggregatibacter actinomycetemcomitans strain IDHaas10a |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A142FYB7 |
Locus tag | N7761_RS07270 | Protein ID | WP_005540089.1 |
Coordinates | 1438360..1438650 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N7761_RS07275 | Protein ID | WP_005545663.1 |
Coordinates | 1438640..1438894 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7761_RS07250 (N7761_07250) | 1434222..1435313 | - | 1092 | WP_014167926.1 | tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA | - |
N7761_RS07255 (N7761_07255) | 1435610..1436998 | - | 1389 | WP_005567594.1 | tRNA 5-hydroxyuridine modification protein YegQ | - |
N7761_RS07260 (N7761_07260) | 1437169..1437621 | - | 453 | WP_006710245.1 | 50S ribosomal protein L11 methyltransferase | - |
N7761_RS07265 (N7761_07265) | 1437962..1438303 | + | 342 | WP_014167925.1 | cupin domain-containing protein | - |
N7761_RS07270 (N7761_07270) | 1438360..1438650 | - | 291 | WP_005540089.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7761_RS07275 (N7761_07275) | 1438640..1438894 | - | 255 | WP_005545663.1 | stability protein StbD | Antitoxin |
N7761_RS07290 (N7761_07290) | 1439346..1440107 | - | 762 | WP_005567590.1 | DNA polymerase III subunit epsilon | - |
N7761_RS07295 (N7761_07295) | 1440175..1440642 | + | 468 | WP_005565412.1 | ribonuclease HI | - |
N7761_RS07300 (N7761_07300) | 1440730..1442061 | - | 1332 | WP_005594223.1 | 3-phosphoshikimate 1-carboxyvinyltransferase | - |
N7761_RS07305 (N7761_07305) | 1442072..1443169 | - | 1098 | WP_005567586.1 | histidinol-phosphate transaminase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11509.34 Da Isoelectric Point: 10.7396
>T259455 WP_005540089.1 NZ_CP104882:c1438650-1438360 [Aggregatibacter actinomycetemcomitans]
MTYKLTFDKRALKEWQKLGDTIRQQFKNKLAERLENPRVPGDKLRGYQNLYKIKLRAAGYRLVYEVNDNQIYILVLSVGK
RNRLDAYKNAEFRQAR
MTYKLTFDKRALKEWQKLGDTIRQQFKNKLAERLENPRVPGDKLRGYQNLYKIKLRAAGYRLVYEVNDNQIYILVLSVGK
RNRLDAYKNAEFRQAR
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|