Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/COG3657-dnstrm_HI1420 |
Location | 128078..128670 | Replicon | chromosome |
Accession | NZ_CP104882 | ||
Organism | Aggregatibacter actinomycetemcomitans strain IDHaas10a |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | N7761_RS00625 | Protein ID | WP_014167707.1 |
Coordinates | 128371..128670 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N7761_RS00620 | Protein ID | WP_005568148.1 |
Coordinates | 128078..128374 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7761_RS00590 (N7761_00590) | 123154..123951 | - | 798 | WP_005568139.1 | ABC transporter permease | - |
N7761_RS00595 (N7761_00595) | 123926..124387 | - | 462 | Protein_118 | extracellular solute-binding protein | - |
N7761_RS00600 (N7761_00600) | 124360..125163 | - | 804 | WP_262088994.1 | oxidoreductase | - |
N7761_RS00605 (N7761_00605) | 125224..125703 | + | 480 | WP_262088995.1 | Cys-tRNA(Pro) deacylase | - |
N7761_RS00610 (N7761_00610) | 126007..127404 | - | 1398 | WP_005592819.1 | MATE family efflux transporter | - |
N7761_RS00615 (N7761_00615) | 127431..128045 | + | 615 | WP_005568146.1 | riboflavin synthase | - |
N7761_RS00620 (N7761_00620) | 128078..128374 | - | 297 | WP_005568148.1 | putative addiction module antidote protein | Antitoxin |
N7761_RS00625 (N7761_00625) | 128371..128670 | - | 300 | WP_014167707.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7761_RS00630 (N7761_00630) | 128838..129140 | + | 303 | WP_005568150.1 | ribosome assembly RNA-binding protein YhbY | - |
N7761_RS00635 (N7761_00635) | 129213..129689 | - | 477 | WP_005572298.1 | transcription elongation factor GreA | - |
N7761_RS00640 (N7761_00640) | 129849..131291 | + | 1443 | WP_014167706.1 | serine-type D-Ala-D-Ala carboxypeptidase | - |
N7761_RS00645 (N7761_00645) | 131392..132048 | - | 657 | WP_005568155.1 | GTP cyclohydrolase I FolE | - |
N7761_RS00650 (N7761_00650) | 132177..133391 | + | 1215 | WP_014167705.1 | molybdopterin molybdotransferase MoeA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11406.53 Da Isoelectric Point: 10.6671
>T259454 WP_014167707.1 NZ_CP104882:c128670-128371 [Aggregatibacter actinomycetemcomitans]
MMIQIKTTFLFDEWLKKLKNLRAKAKINARIKRLQFGNFGDLKSVNDGIFEMRIDKGQGYRVYLKNQNGILVILLCGGDK
STQEKDIKKAKQLAQEMGL
MMIQIKTTFLFDEWLKKLKNLRAKAKINARIKRLQFGNFGDLKSVNDGIFEMRIDKGQGYRVYLKNQNGILVILLCGGDK
STQEKDIKKAKQLAQEMGL
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|