Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hipBA/HipA-HipB |
| Location | 90516..91185 | Replicon | chromosome |
| Accession | NZ_CP104882 | ||
| Organism | Aggregatibacter actinomycetemcomitans strain IDHaas10a | ||
Toxin (Protein)
| Gene name | hipA | Uniprot ID | - |
| Locus tag | N7761_RS00445 | Protein ID | WP_005573679.1 |
| Coordinates | 90847..91185 (+) | Length | 113 a.a. |
Antitoxin (Protein)
| Gene name | hipB | Uniprot ID | - |
| Locus tag | N7761_RS00440 | Protein ID | WP_014167717.1 |
| Coordinates | 90516..90797 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7761_RS00425 (N7761_00425) | 86994..87476 | - | 483 | WP_005544145.1 | Dps family protein | - |
| N7761_RS00430 (N7761_00430) | 87685..88845 | + | 1161 | WP_005545814.1 | EmrA/EmrK family multidrug efflux transporter periplasmic adaptor subunit | - |
| N7761_RS00435 (N7761_00435) | 88855..90372 | + | 1518 | WP_005545812.1 | DHA2 family efflux MFS transporter permease subunit | - |
| N7761_RS00440 (N7761_00440) | 90516..90797 | + | 282 | WP_014167717.1 | helix-turn-helix domain-containing protein | Antitoxin |
| N7761_RS00445 (N7761_00445) | 90847..91185 | + | 339 | WP_005573679.1 | HipA N-terminal domain-containing protein | Toxin |
| N7761_RS00450 (N7761_00450) | 91179..91295 | + | 117 | WP_005545808.1 | hypothetical protein | - |
| N7761_RS00455 (N7761_00455) | 91295..91417 | + | 123 | WP_005573281.1 | hypothetical protein | - |
| N7761_RS00460 (N7761_00460) | 91414..92307 | - | 894 | WP_005545804.1 | hypothetical protein | - |
| N7761_RS00465 (N7761_00465) | 92374..95238 | - | 2865 | WP_053330372.1 | valine--tRNA ligase | - |
| N7761_RS00470 (N7761_00470) | 95322..95750 | - | 429 | WP_080996242.1 | DUF2726 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 13104.85 Da Isoelectric Point: 8.6930
>T259453 WP_005573679.1 NZ_CP104882:90847-91185 [Aggregatibacter actinomycetemcomitans]
MAKAHKWPTEFQYPPKWLDSARSRPISLSLPLSHKVYREDSVYNFFDNLLPDNEQIRSRIQQRFQTSTKSPFDLLSAIEQ
DCVGAIQLYHGESRSVRQIYAEPLNDKKCKTC
MAKAHKWPTEFQYPPKWLDSARSRPISLSLPLSHKVYREDSVYNFFDNLLPDNEQIRSRIQQRFQTSTKSPFDLLSAIEQ
DCVGAIQLYHGESRSVRQIYAEPLNDKKCKTC
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|