Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1324759..1325675 | Replicon | chromosome |
| Accession | NZ_CP104878 | ||
| Organism | Bacillus subtilis strain 4ZT | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | O34853 |
| Locus tag | N8A75_RS06950 | Protein ID | WP_003244695.1 |
| Coordinates | 1324929..1325675 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | G4EXD8 |
| Locus tag | N8A75_RS06945 | Protein ID | WP_003232646.1 |
| Coordinates | 1324759..1324929 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8A75_RS06910 (1321619) | 1321619..1321948 | + | 330 | WP_046380959.1 | XkdW family protein | - |
| N8A75_RS06915 (1321945) | 1321945..1322109 | + | 165 | WP_014479563.1 | XkdX family protein | - |
| N8A75_RS06920 (1322156) | 1322156..1322995 | + | 840 | WP_046380960.1 | phage-like element PBSX protein XepA | - |
| N8A75_RS06925 (1323048) | 1323048..1323317 | + | 270 | WP_015252265.1 | hemolysin XhlA family protein | - |
| N8A75_RS06930 (1323330) | 1323330..1323593 | + | 264 | WP_003232653.1 | phage holin | - |
| N8A75_RS06935 (1323606) | 1323606..1324499 | + | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
| N8A75_RS06940 (1324536) | 1324536..1324673 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
| N8A75_RS06945 (1324759) | 1324759..1324929 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
| N8A75_RS06950 (1324929) | 1324929..1325675 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
| N8A75_RS06955 (1325785) | 1325785..1326786 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
| N8A75_RS06960 (1326799) | 1326799..1327416 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
| N8A75_RS06965 (1327692) | 1327692..1329008 | - | 1317 | WP_046380961.1 | serine/threonine exchanger | - |
| N8A75_RS06970 (1329397) | 1329397..1330347 | + | 951 | WP_014479571.1 | ring-cleaving dioxygenase | - |
| N8A75_RS06975 (1330455) | 1330455..1330550 | + | 96 | Protein_1310 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T259438 WP_003244695.1 NZ_CP104878:c1325675-1324929 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|