Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 519294..519930 | Replicon | chromosome |
Accession | NZ_CP104878 | ||
Organism | Bacillus subtilis strain 4ZT |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | N8A75_RS02655 | Protein ID | WP_003156187.1 |
Coordinates | 519580..519930 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | N8A75_RS02650 | Protein ID | WP_003225183.1 |
Coordinates | 519294..519575 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8A75_RS02630 (515653) | 515653..516252 | - | 600 | WP_032722928.1 | rhomboid family intramembrane serine protease | - |
N8A75_RS02635 (516347) | 516347..516712 | + | 366 | WP_015252768.1 | holo-ACP synthase | - |
N8A75_RS02640 (516878) | 516878..517894 | + | 1017 | WP_080019556.1 | outer membrane lipoprotein carrier protein LolA | - |
N8A75_RS02645 (518009) | 518009..519178 | + | 1170 | WP_015252766.1 | alanine racemase | - |
N8A75_RS02650 (519294) | 519294..519575 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
N8A75_RS02655 (519580) | 519580..519930 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
N8A75_RS02660 (520045) | 520045..520869 | + | 825 | WP_015252765.1 | RsbT co-antagonist protein RsbRA | - |
N8A75_RS02665 (520874) | 520874..521239 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
N8A75_RS02670 (521243) | 521243..521644 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
N8A75_RS02675 (521656) | 521656..522663 | + | 1008 | WP_015252763.1 | phosphoserine phosphatase RsbU | - |
N8A75_RS02680 (522725) | 522725..523054 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
N8A75_RS02685 (523051) | 523051..523533 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
N8A75_RS02690 (523499) | 523499..524287 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
N8A75_RS02695 (524287) | 524287..524886 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T259437 WP_003156187.1 NZ_CP104878:519580-519930 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|