Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 4972920..4973560 | Replicon | chromosome |
Accession | NZ_CP104870 | ||
Organism | Pseudomonas aeruginosa strain PALA9 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PALA9_RS23220 | Protein ID | WP_003134109.1 |
Coordinates | 4972920..4973330 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PALA9_RS23225 | Protein ID | WP_031634724.1 |
Coordinates | 4973330..4973560 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA9_RS23180 | 4968446..4969243 | + | 798 | WP_235597565.1 | hypothetical protein | - |
PALA9_RS23185 (PALA9_04589) | 4969400..4970128 | + | 729 | WP_004352842.1 | TIGR03761 family integrating conjugative element protein | - |
PALA9_RS23190 (PALA9_04590) | 4970134..4970682 | + | 549 | WP_004352841.1 | DUF3158 family protein | - |
PALA9_RS23195 (PALA9_04591) | 4970729..4971568 | + | 840 | WP_003105750.1 | Rha family transcriptional regulator | - |
PALA9_RS23200 (PALA9_04592) | 4971598..4972086 | + | 489 | WP_004352840.1 | single-stranded DNA-binding protein | - |
PALA9_RS23205 | 4972242..4972409 | + | 168 | WP_128729268.1 | CrpP family ICE-associated protein | - |
PALA9_RS23210 (PALA9_04593) | 4972475..4972693 | - | 219 | WP_023083218.1 | hypothetical protein | - |
PALA9_RS23215 (PALA9_04594) | 4972707..4972904 | - | 198 | WP_023083219.1 | hypothetical protein | - |
PALA9_RS23220 (PALA9_04595) | 4972920..4973330 | - | 411 | WP_003134109.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PALA9_RS23225 | 4973330..4973560 | - | 231 | WP_031634724.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PALA9_RS23230 (PALA9_04596) | 4973816..4975735 | + | 1920 | WP_004352838.1 | type I DNA topoisomerase | - |
PALA9_RS23235 | 4976043..4976252 | + | 210 | WP_003105733.1 | cold-shock protein | - |
PALA9_RS23240 (PALA9_04597) | 4976473..4978362 | + | 1890 | WP_003105732.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 4954563..5043406 | 88843 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15452.78 Da Isoelectric Point: 7.3233
>T259434 WP_003134109.1 NZ_CP104870:c4973330-4972920 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|