Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2846018..2847060 | Replicon | chromosome |
Accession | NZ_CP104870 | ||
Organism | Pseudomonas aeruginosa strain PALA9 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PALA9_RS13495 | Protein ID | WP_003153636.1 |
Coordinates | 2846485..2847060 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | PALA9_RS13490 | Protein ID | WP_003050245.1 |
Coordinates | 2846018..2846488 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA9_RS13455 (PALA9_02674) | 2841410..2842828 | - | 1419 | WP_006226029.1 | TIGR03752 family integrating conjugative element protein | - |
PALA9_RS13460 (PALA9_02675) | 2842818..2843729 | - | 912 | WP_006226028.1 | TIGR03749 family integrating conjugative element protein | - |
PALA9_RS13465 (PALA9_02676) | 2843726..2844418 | - | 693 | WP_003090182.1 | TIGR03746 family integrating conjugative element protein | - |
PALA9_RS13470 (PALA9_02677) | 2844415..2844813 | - | 399 | WP_003050133.1 | TIGR03750 family conjugal transfer protein | - |
PALA9_RS13475 (PALA9_02678) | 2844825..2845184 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
PALA9_RS13480 (PALA9_02679) | 2845201..2845434 | - | 234 | WP_006226027.1 | TIGR03758 family integrating conjugative element protein | - |
PALA9_RS13485 (PALA9_02680) | 2845431..2845814 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
PALA9_RS13490 (PALA9_02681) | 2846018..2846488 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
PALA9_RS13495 (PALA9_02682) | 2846485..2847060 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
PALA9_RS13500 (PALA9_02683) | 2847078..2847992 | + | 915 | WP_016852809.1 | AAA family ATPase | - |
PALA9_RS13505 (PALA9_02684) | 2847989..2848459 | + | 471 | WP_003090160.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
PALA9_RS13510 (PALA9_02685) | 2848456..2848956 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
PALA9_RS13515 (PALA9_02686) | 2848956..2849858 | + | 903 | WP_003090158.1 | CBASS oligonucleotide cyclase | - |
PALA9_RS13520 (PALA9_02687) | 2849897..2850622 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2771454..2893177 | 121723 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T259431 WP_003153636.1 NZ_CP104870:2846485-2847060 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT259431 WP_003050245.1 NZ_CP104870:2846018-2846488 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|