Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PP_4151-4152/excise(antitoxin)
Location 2846018..2847060 Replicon chromosome
Accession NZ_CP104870
Organism Pseudomonas aeruginosa strain PALA9

Toxin (Protein)


Gene name PP_4152 Uniprot ID -
Locus tag PALA9_RS13495 Protein ID WP_003153636.1
Coordinates 2846485..2847060 (+) Length 192 a.a.

Antitoxin (Protein)


Gene name PP_4151 Uniprot ID I3TV68
Locus tag PALA9_RS13490 Protein ID WP_003050245.1
Coordinates 2846018..2846488 (+) Length 157 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PALA9_RS13455 (PALA9_02674) 2841410..2842828 - 1419 WP_006226029.1 TIGR03752 family integrating conjugative element protein -
PALA9_RS13460 (PALA9_02675) 2842818..2843729 - 912 WP_006226028.1 TIGR03749 family integrating conjugative element protein -
PALA9_RS13465 (PALA9_02676) 2843726..2844418 - 693 WP_003090182.1 TIGR03746 family integrating conjugative element protein -
PALA9_RS13470 (PALA9_02677) 2844415..2844813 - 399 WP_003050133.1 TIGR03750 family conjugal transfer protein -
PALA9_RS13475 (PALA9_02678) 2844825..2845184 - 360 WP_003090173.1 TIGR03745 family integrating conjugative element membrane protein -
PALA9_RS13480 (PALA9_02679) 2845201..2845434 - 234 WP_006226027.1 TIGR03758 family integrating conjugative element protein -
PALA9_RS13485 (PALA9_02680) 2845431..2845814 - 384 WP_003090167.1 RAQPRD family integrative conjugative element protein -
PALA9_RS13490 (PALA9_02681) 2846018..2846488 + 471 WP_003050245.1 helix-turn-helix domain-containing protein Antitoxin
PALA9_RS13495 (PALA9_02682) 2846485..2847060 + 576 WP_003153636.1 PIN domain-containing protein Toxin
PALA9_RS13500 (PALA9_02683) 2847078..2847992 + 915 WP_016852809.1 AAA family ATPase -
PALA9_RS13505 (PALA9_02684) 2847989..2848459 + 471 WP_003090160.1 type III CBASS phage resistance system CD-NTase-associated protein Cap8 -
PALA9_RS13510 (PALA9_02685) 2848456..2848956 + 501 WP_003090159.1 type III CBASS phage resistance system CD-NTase-associated protein Cap7 -
PALA9_RS13515 (PALA9_02686) 2848956..2849858 + 903 WP_003090158.1 CBASS oligonucleotide cyclase -
PALA9_RS13520 (PALA9_02687) 2849897..2850622 + 726 WP_003050273.1 CBASS effector endonuclease NucC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 2771454..2893177 121723


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(9-114)

Antitoxin

Helix-turn-helix domain, group 17

(85-133)


Sequences

Toxin        


Download         Length: 192 a.a.        Molecular weight: 21629.78 Da        Isoelectric Point: 5.9995

>T259431 WP_003153636.1 NZ_CP104870:2846485-2847060 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL

Download         Length: 576 bp

Antitoxin


Download         Length: 157 a.a.        Molecular weight: 17245.62 Da        Isoelectric Point: 6.3803

>AT259431 WP_003050245.1 NZ_CP104870:2846018-2846488 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE

Download         Length: 471 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB I3TV68

References