Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 5109901..5110509 | Replicon | chromosome |
Accession | NZ_CP104869 | ||
Organism | Pseudomonas aeruginosa strain PALA8 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | Q9I5J9 |
Locus tag | PALA8_RS23740 | Protein ID | WP_003114156.1 |
Coordinates | 5109901..5110248 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | PALA8_RS23745 | Protein ID | WP_003114155.1 |
Coordinates | 5110258..5110509 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA8_RS23710 (PALA8_04723) | 5105260..5105532 | + | 273 | WP_003134390.1 | cysteine-rich CWC family protein | - |
PALA8_RS23715 (PALA8_04724) | 5105532..5106224 | + | 693 | WP_003085458.1 | 16S rRNA pseudouridine(516) synthase | - |
PALA8_RS23720 (PALA8_04725) | 5106360..5107403 | + | 1044 | WP_003134392.1 | L,D-transpeptidase | - |
PALA8_RS23725 (PALA8_04726) | 5107483..5108220 | + | 738 | WP_003124252.1 | murein L,D-transpeptidase catalytic domain family protein | - |
PALA8_RS23730 (PALA8_04727) | 5108672..5109574 | + | 903 | WP_003085447.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
PALA8_RS23740 (PALA8_04729) | 5109901..5110248 | - | 348 | WP_003114156.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA8_RS23745 | 5110258..5110509 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PALA8_RS23750 | 5110723..5111705 | - | 983 | Protein_4701 | tyrosine-type recombinase/integrase | - |
PALA8_RS23755 (PALA8_04732) | 5111705..5112997 | - | 1293 | WP_003134394.1 | hypothetical protein | - |
PALA8_RS23760 (PALA8_04734) | 5113227..5114510 | - | 1284 | WP_023127773.1 | zonular occludens toxin domain-containing protein | - |
PALA8_RS23765 (PALA8_04735) | 5114514..5114870 | - | 357 | WP_003114150.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 5109901..5119233 | 9332 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12984.78 Da Isoelectric Point: 4.4212
>T259426 WP_003114156.1 NZ_CP104869:c5110248-5109901 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9I5J9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |