Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 4716050..4716690 | Replicon | chromosome |
Accession | NZ_CP104869 | ||
Organism | Pseudomonas aeruginosa strain PALA8 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PALA8_RS21790 | Protein ID | WP_003134109.1 |
Coordinates | 4716050..4716460 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PALA8_RS21795 | Protein ID | WP_031634724.1 |
Coordinates | 4716460..4716690 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA8_RS21755 | 4712329..4712793 | - | 465 | WP_154070642.1 | hypothetical protein | - |
PALA8_RS21760 (PALA8_04336) | 4713050..4713778 | + | 729 | WP_023094843.1 | TIGR03761 family integrating conjugative element protein | - |
PALA8_RS21765 | 4713784..4714319 | + | 536 | Protein_4311 | DUF3158 family protein | - |
PALA8_RS21770 (PALA8_04338) | 4714333..4714821 | + | 489 | WP_003134107.1 | single-stranded DNA-binding protein | - |
PALA8_RS21775 | 4714926..4715120 | + | 195 | WP_031632157.1 | hypothetical protein | - |
PALA8_RS21780 | 4715372..4715539 | + | 168 | WP_128729268.1 | CrpP family ICE-associated protein | - |
PALA8_RS21785 (PALA8_04340) | 4715840..4716034 | - | 195 | WP_023094845.1 | hypothetical protein | - |
PALA8_RS21790 (PALA8_04341) | 4716050..4716460 | - | 411 | WP_003134109.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PALA8_RS21795 | 4716460..4716690 | - | 231 | WP_031634724.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PALA8_RS21800 (PALA8_04342) | 4717008..4718927 | + | 1920 | WP_003134111.1 | type I DNA topoisomerase | - |
PALA8_RS21805 (PALA8_04344) | 4719109..4719687 | + | 579 | WP_023094847.1 | hypothetical protein | - |
PALA8_RS21810 (PALA8_04345) | 4719804..4720409 | - | 606 | WP_023094848.1 | LysE family translocator | - |
PALA8_RS21815 (PALA8_04346) | 4720531..4721400 | + | 870 | WP_023094849.1 | LysR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | katA | 4698735..4817353 | 118618 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15452.78 Da Isoelectric Point: 7.3233
>T259424 WP_003134109.1 NZ_CP104869:c4716460-4716050 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|