Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/- |
Location | 1627071..1627666 | Replicon | chromosome |
Accession | NZ_CP104867 | ||
Organism | Pseudomonas aeruginosa strain PALA6 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | Q58CI8 |
Locus tag | PALA6_RS07770 | Protein ID | WP_004348413.1 |
Coordinates | 1627325..1627666 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | Q58CI7 |
Locus tag | PALA6_RS07765 | Protein ID | WP_004348412.1 |
Coordinates | 1627071..1627319 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA6_RS07740 (PALA6_01539) | 1622255..1622506 | + | 252 | WP_004348403.1 | major capsid protein | - |
PALA6_RS07745 (PALA6_01540) | 1622647..1623945 | + | 1299 | Protein_1519 | attachment protein | - |
PALA6_RS07750 (PALA6_01541) | 1623949..1624305 | + | 357 | WP_004348407.1 | DUF2523 family protein | - |
PALA6_RS07755 (PALA6_01542) | 1624309..1625458 | + | 1150 | Protein_1521 | hypothetical protein | - |
PALA6_RS07760 (PALA6_01544) | 1625696..1626970 | + | 1275 | WP_004348411.1 | hypothetical protein | - |
PALA6_RS07765 (PALA6_01545) | 1627071..1627319 | + | 249 | WP_004348412.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PALA6_RS07770 (PALA6_01546) | 1627325..1627666 | + | 342 | WP_004348413.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA6_RS07775 (PALA6_01547) | 1628149..1629141 | + | 993 | WP_004348414.1 | 1,2-glucosyltransferase WapB | - |
PALA6_RS07780 (PALA6_01548) | 1629181..1629981 | - | 801 | WP_004348415.1 | IclR family transcriptional regulator | - |
PALA6_RS07785 (PALA6_01549) | 1630139..1630525 | + | 387 | WP_003086280.1 | OB-fold domain-containing protein | - |
PALA6_RS07790 (PALA6_01550) | 1630522..1631673 | + | 1152 | WP_004348416.1 | thiolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1612900..1629141 | 16241 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12942.62 Da Isoelectric Point: 4.5106
>T259409 WP_004348413.1 NZ_CP104867:1627325-1627666 [Pseudomonas aeruginosa]
MTVREIRFTETAVFSIQDQEEHLADYHPPELAAAKIDGLIDEILTRLQDAPVGYPVSRQASDLGVTRYRELNHDGYRVLY
EAYEHENVIAVELVLRQKQDVEAALIRYCLVGI
MTVREIRFTETAVFSIQDQEEHLADYHPPELAAAKIDGLIDEILTRLQDAPVGYPVSRQASDLGVTRYRELNHDGYRVLY
EAYEHENVIAVELVLRQKQDVEAALIRYCLVGI
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|