Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 5546565..5547151 | Replicon | chromosome |
Accession | NZ_CP104866 | ||
Organism | Pseudomonas aeruginosa strain PALA4 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | PALA4_RS25820 | Protein ID | WP_003120987.1 |
Coordinates | 5546852..5547151 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PALA4_RS25815 | Protein ID | WP_003448662.1 |
Coordinates | 5546565..5546855 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA4_RS25795 (PALA4_05101) | 5542159..5544036 | + | 1878 | WP_023911870.1 | hypothetical protein | - |
PALA4_RS25800 (PALA4_05102) | 5544033..5546009 | + | 1977 | WP_031275715.1 | DEAD/DEAH box helicase | - |
PALA4_RS25805 | 5546019..5546153 | + | 135 | WP_033179080.1 | hypothetical protein | - |
PALA4_RS25810 | 5546150..5546494 | + | 345 | WP_003448665.1 | hypothetical protein | - |
PALA4_RS25815 (PALA4_05103) | 5546565..5546855 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
PALA4_RS25820 | 5546852..5547151 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA4_RS25825 (PALA4_05104) | 5547352..5548476 | + | 1125 | WP_023435880.1 | TcpQ domain-containing protein | - |
PALA4_RS25830 (PALA4_05105) | 5548476..5550185 | + | 1710 | WP_023435879.1 | PilN family type IVB pilus formation outer membrane protein | - |
PALA4_RS25835 (PALA4_05106) | 5550189..5551514 | + | 1326 | WP_023435878.1 | type 4b pilus protein PilO2 | - |
PALA4_RS25840 (PALA4_05107) | 5551504..5552037 | + | 534 | WP_023435877.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5522260..5621662 | 99402 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T259405 WP_003120987.1 NZ_CP104866:c5547151-5546852 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|