Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 5429081..5429718 | Replicon | chromosome |
Accession | NZ_CP104866 | ||
Organism | Pseudomonas aeruginosa strain PALA4 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | PALA4_RS25270 | Protein ID | WP_019725766.1 |
Coordinates | 5429536..5429718 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PALA4_RS25265 | Protein ID | WP_019725767.1 |
Coordinates | 5429081..5429503 (-) | Length | 141 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA4_RS25240 (PALA4_04991) | 5425255..5425731 | + | 477 | WP_023122758.1 | phage tail assembly chaperone | - |
PALA4_RS25245 (PALA4_04992) | 5425728..5426651 | + | 924 | WP_023122759.1 | hypothetical protein | - |
PALA4_RS25250 (PALA4_04993) | 5426648..5427190 | + | 543 | WP_023122760.1 | hypothetical protein | - |
PALA4_RS25255 (PALA4_04994) | 5427187..5427879 | + | 693 | WP_023122761.1 | hypothetical protein | - |
PALA4_RS25260 (PALA4_04995) | 5427864..5428835 | + | 972 | WP_023122762.1 | hypothetical protein | - |
PALA4_RS25265 (PALA4_04997) | 5429081..5429503 | - | 423 | WP_019725767.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PALA4_RS25270 (PALA4_04998) | 5429536..5429718 | - | 183 | WP_019725766.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PALA4_RS25275 (PALA4_04999) | 5430249..5431181 | - | 933 | WP_003120918.1 | ZIP family metal transporter | - |
PALA4_RS25280 (PALA4_05000) | 5431200..5431811 | - | 612 | WP_003098862.1 | superoxide dismutase | - |
PALA4_RS25285 (PALA4_05001) | 5431824..5432273 | - | 450 | WP_003094369.1 | hypothetical protein | - |
PALA4_RS25290 (PALA4_05002) | 5432301..5433677 | - | 1377 | WP_003098863.1 | class II fumarate hydratase FumC | - |
PALA4_RS25295 (PALA4_05003) | 5433670..5434065 | - | 396 | WP_003094374.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6970.07 Da Isoelectric Point: 10.2954
>T259404 WP_019725766.1 NZ_CP104866:c5429718-5429536 [Pseudomonas aeruginosa]
MKYSEFRRWLKARGVIFEPAKGSHFKVYYGDNQTIFPDHGAKEIGDGLRKKIIKDLGLKD
MKYSEFRRWLKARGVIFEPAKGSHFKVYYGDNQTIFPDHGAKEIGDGLRKKIIKDLGLKD
Download Length: 183 bp
Antitoxin
Download Length: 141 a.a. Molecular weight: 14970.22 Da Isoelectric Point: 4.9047
>AT259404 WP_019725767.1 NZ_CP104866:c5429503-5429081 [Pseudomonas aeruginosa]
MFDYPVTVHEEAGSVWVSCDDVPEMASAGDTVDEALLDAVEGLESALSLYVDRRQSIPLPSKGKAGQSIVRLPALTSAKI
ALWNTMLAQNVGKAELARRLGVNRVQVDRLVDLLHGSKIEAVEHALAILGQRLAVTVIAA
MFDYPVTVHEEAGSVWVSCDDVPEMASAGDTVDEALLDAVEGLESALSLYVDRRQSIPLPSKGKAGQSIVRLPALTSAKI
ALWNTMLAQNVGKAELARRLGVNRVQVDRLVDLLHGSKIEAVEHALAILGQRLAVTVIAA
Download Length: 423 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|